Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR374 IGR372 IGR373 IGR375 TP0522 TP0518 murG, - TP0523 TP0520 TP0521 ntrC,atoC, - TP0519 mviN, - TP0516 lon-2, - TP0524 TP0522 TP0518 murG, - TP0523 TP0520 TP0521 ntrC,atoC, - TP0519 mviN, - TP0516 lon-2, - TP0524 Type: tandem, Name:  - 295 Type: tandem, Name:  - 120 Type: tandem, Name:  - 121 Type: tandem, Name:  - 294 TP0522 TP0518 murG, - TP0523 TP0520 TP0521 ntrC,atoC, - TP0519 mviN, - TP0516 lon-2, - TP0524 ruvC, - TP0517 ruvC, - TP0517
* Calculated from Protein Sequence

Gene ID: TP0521

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:
3322812

Gene Name:


Definition:
possible DNA polymerase III gamma and tau subunits

Gene Start:
563007

Gene Stop:
561739

Gene Length:
1269

Molecular Weight*:
48223

pI*:
8.14

Net Charge*:
8.11

EC:
2.7.7.7  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Nucleotide metabolism; Purine Metabolism

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the N-terminal and middle region had several
significant hits to hypothetical proteins and DNA polymerase III
gamma and tau subunits. However only one protein had a single continous
hit from the N-terminal region through the middle of the protein.
Residues 23-263 are 22% similar to B. burgdorferi predicted coding
region BB0765,(AE001176).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0470
COG name: ATPase involved in DNA replication
Functional Class:  L
The phylogenetic pattern of COG0470 is AMTKYQVCEBRHUJGPOLINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 26-41 represent a significant (99%) hit to blocks PR00819B,
CBXX/CFQX SUPERFAMILY SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 202-249 are 43% similar to DNA polymerase III, gamma and tau subunits
of DP3X_BACSU, however the score is low.

Paralogs:  Local Blast Search
This protein is paralogously related to TP1005 DNA polymerase III,
subunits gamma and tau. Residues 182-256 are 38% similar and residues
2-69 are 30% similar to TP1005.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MFENIVGQPATDLLRDDVMHARLPAALLFVGPPASGKLTAALELARVLSC
TQGGVWQCPCAPCVQHTELLSPELLVMGIKDLILEIRASARAYMSVHTQG
TRYLFVRAVRKLITRFDERLWDSDDTRFSAAVSSIAELDQELASLPAQGD
RRTTPEQKERVQRICVIAERLQQESLYTQLPVQQIRNAIQWVRLTPSGRK
KVLIIEHAHAMHESARTAFLKILEEPPRDTLFILTTATKYAIMPTVLSRV
RSYSFRERSVELQCAVITRVFHDRPTDAKNTQGVLLHYLYQFLSFSLEEV
QTSVMYFWLYVCQHARCIGRIIPDTWVSVGTQPQVSGMDLTSLDSTLHFF
QAHKQQHAVSLFFSLLVRHMRTLQRTTEYSARNTECFAHIAHCIEQAHRN
VQLWNLTIQGTLEHLAHTIANHL

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTCGAGAACATTGTCGGACAGCCAGCTACTGACCTTCTGCGCGATGA
TGTTATGCACGCGCGTCTTCCTGCTGCGCTCTTATTTGTTGGACCACCCG
CTAGTGGCAAGCTAACTGCTGCACTTGAGCTTGCGCGCGTGCTTTCCTGT
ACGCAGGGGGGCGTGTGGCAGTGTCCTTGTGCACCCTGTGTGCAGCATAC
GGAGTTACTTTCTCCAGAACTACTCGTGATGGGGATAAAAGATCTGATCC
TCGAAATACGCGCGTCGGCACGTGCCTATATGTCAGTGCACACGCAGGGT
ACGCGCTATCTTTTTGTGCGGGCAGTGCGTAAACTCATTACACGCTTTGA
CGAACGACTGTGGGATAGTGATGATACTCGTTTCTCTGCCGCGGTTTCGA
GCATTGCTGAGCTCGACCAGGAGCTCGCATCACTCCCCGCACAGGGAGAC
CGACGTACCACTCCAGAGCAAAAAGAAAGAGTGCAAAGGATATGCGTGAT
CGCCGAAAGGCTACAGCAGGAGTCACTCTATACCCAATTACCCGTACAGC
AAATACGAAACGCAATTCAGTGGGTGCGTCTTACACCCTCAGGAAGAAAG
AAAGTGCTGATCATAGAACACGCGCACGCGATGCATGAATCTGCACGAAC
TGCTTTTCTAAAGATATTAGAAGAACCTCCGCGCGATACGCTTTTTATCC
TCACTACCGCTACAAAGTATGCAATCATGCCTACTGTCCTTTCGCGTGTG
CGCAGTTATTCTTTCAGAGAAAGAAGTGTTGAACTCCAATGTGCAGTAAT
TACACGCGTATTTCATGACAGACCGACCGATGCAAAAAACACACAGGGTG
TACTCTTGCACTATTTATATCAGTTTTTGTCGTTTTCTTTAGAAGAGGTG
CAAACGTCCGTGATGTACTTTTGGCTGTATGTGTGCCAGCACGCTAGGTG
TATCGGACGCATCATTCCTGATACTTGGGTTTCGGTAGGTACTCAACCTC
AAGTATCAGGAATGGATCTTACCTCACTTGATTCTACGCTGCATTTTTTC
CAAGCTCACAAACAGCAACACGCCGTGTCCCTTTTTTTCTCCTTACTCGT
CAGGCACATGCGCACCCTGCAGCGCACCACCGAGTACTCCGCACGGAATA
CAGAATGCTTCGCACACATTGCTCACTGTATCGAACAGGCACATCGCAAT
GTGCAGTTGTGGAATCTAACAATACAAGGGACTCTCGAACACTTAGCACA
CACCATCGCGAATCATCTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy