Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR372 IGR373 IGR371 TP0522 TP0518 TP0520 TP0521 ntrC,atoC, - TP0519 mviN, - TP0516 uvrA, - TP0514 TP0515 TP0522 TP0518 TP0520 TP0521 ntrC,atoC, - TP0519 mviN, - TP0516 uvrA, - TP0514 TP0515 Type: tandem, Name:  - 119 Type: tandem, Name:  - 120 Type: tandem, Name:  - 294 TP0518 TP0520 TP0521 ntrC,atoC, - TP0519 mviN, - TP0516 ruvC, - TP0517 ruvC, - TP0517 TP0522 uvrA, - TP0514 TP0515
* Calculated from Protein Sequence

Gene ID: TP0517

DNA Molecule Name:
1  

Genomic Island ID:
1

Genbank ID:
3322809

Gene Name:
ruvC  

Definition:
Holliday junction nuclease, subunit C

Gene Start:
558494

Gene Stop:
557907

Gene Length:
588

Molecular Weight*:
20927

pI*:
9.36

Net Charge*:
7.67

EC:
3.1.22.4  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Sukhodolets VV.
[Effect of mutations for the ruvABC genes on recombination between direct DNA repairs in Escherichia coli strains carrying extended tandem duplication].
Genetika. 2002 Sep;38(9):1215-22.
PMID: 12391882

Sha R, Liu F, Iwasaki H, Seeman NC.
Parallel symmetric immobile DNA junctions as substrates for E. coli RuvC Holliday junction resolvase.
Biochemistry. 2002 Sep;41(36):10985-93.
PMID: 12206670

Zahradka K, Zahradka D, Petranović M.
Loss of lambda prophage recombinogenicity in UV-irradiated Escherichia coli: the role of host genes ruvA, ruvB, ruvC, and recG.
Res Microbiol. 2001 Dec;152(10):873-81.
PMID: 11766962

Comment:
This enzyme is a nuclease that resolves Holliday junction intermediates
in genetic recombination. It cleaves the cruciform structure in
supercoiled DNA by nicking to strands with the same polarity at sites
symmetrically opposed at the junction in the homologous arms and leaves
a 5' terminal phosphate and a 3' terminal hydroxyl group.

Reaction:
Endonucleolytic cleavage at a junction such as a reciprocal
single-stranded crossover between two homologous DNA duplexes.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to ruvC proteins. For
example residues 16-169 are 46% similar to RUVC_ECOLI, crossover
junction endodeoxyribonuclease RuvC of Escherichia coli, (accession#
D10165).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0817
COG name: Holliday junction endodeoxyribonuclease RuvC
Functional Class:? L
The phylogenetic pattern of COG0817 is ------vce-rhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 20-33, 77-93, 99-115, 123-142 and 155-167 represent significant
(100%) hits to blocks (PR00696A,B,C,D,E), CROSSOVER JUNCTION
ENDODEOXYRIBONUCLEASE RUVC SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 60-148 are 44% similar to Holliday junction nuclease, subunit
C of RUVC_ECOLI. Residues 17-52 also represent a weak hit to ruvC
proteins.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 19 to 167 (E-value = 9.8e-99) place TP0517 in the RuvC family which is described as Crossover junction endodeoxyribonuclease RuvC (PF02075)

PDB Hit:
gi|999741|pdb|1HJR|A Escherichia coli

Gene Protein Sequence:
MHAQNVDIAPGSTSTVSIIVGIDPGLESTGYGVIEAGGGSLRCLTYGVIV
TQSNQPSAARLRHIFDTLQQVISIYQPQYCAVETIYFAKNVTSALCVAQA
RGVVLLAMAQQHISVAEYAPNAIKKAITGIAQAEKRQVQHLVKILLNLKD
IPHPDHAADALAVAVTHVHCCMSSNYAVGSTRSRGAYVTLYKKGKR

Gene Nucleotide Sequence:  Sequence Viewer
GTGCACGCACAGAACGTAGATATTGCGCCGGGCAGTACCTCGACCGTTTC
CATCATAGTGGGTATTGACCCAGGACTTGAATCTACCGGATACGGCGTTA
TAGAAGCAGGGGGAGGCAGTCTGCGCTGTCTTACCTACGGGGTGATTGTT
ACCCAAAGCAATCAGCCATCTGCTGCACGACTCAGACACATCTTCGATAC
CCTGCAACAGGTAATCTCAATATATCAACCTCAGTATTGCGCAGTGGAGA
CAATCTATTTCGCAAAGAATGTAACCAGTGCGTTGTGTGTTGCGCAAGCG
CGTGGGGTTGTATTACTTGCTATGGCACAACAGCACATTTCAGTAGCTGA
ATACGCACCGAATGCGATTAAAAAAGCAATAACTGGTATTGCCCAAGCAG
AAAAAAGACAGGTACAGCATTTGGTAAAAATTTTACTCAATCTTAAGGAT
ATACCTCATCCTGATCACGCTGCTGATGCCCTAGCGGTTGCTGTTACCCA
TGTACACTGTTGTATGTCTTCAAACTATGCGGTAGGTTCAACGCGCTCTA
GGGGAGCGTACGTTACGCTGTACAAAAAAGGTAAGAGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy