Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR367 IGR368 IGR369 IGR365 IGR370 IGR366 IGR364 lepA, - TP0510 ahpC, - TP0509 ydeB, - TP0511 TP0512 clpX, - TP0508 tig, - TP0506 trkA, - TP0513 uvrA, - TP0514 lepA, - TP0510 ahpC, - TP0509 ydeB, - TP0511 TP0512 clpX, - TP0508 tig, - TP0506 trkA, - TP0513 uvrA, - TP0514 Type: tandem, Name:  - 115 Type: tandem, Name:  - 116 lepA, - TP0510 ahpC, - TP0509 ydeB, - TP0511 TP0512 clpX, - TP0508 tig, - TP0506 trkA, - TP0513 uvrA, - TP0514 clpP, - TP0507 clpP, - TP0507
* Calculated from Protein Sequence

Gene ID: TP0510

DNA Molecule Name:
1  

Genbank ID:
3322802

Gene Name:
lepA  

Definition:
GTP-binding membrane protein

Gene Start:
546958

Gene Stop:
545144

Gene Length:
1815

Molecular Weight*:
67614

pI*:
6.22

Net Charge*:
-7.80

EC:
 

Functional Class:
Translation; Translation factors  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to GTP-binding membrane
protein LepA. For example residues 46-600 are 58% similar to
GTP-binding membrane protein (lepA) of Borrelia burgdorferi,(AE001121).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0481
COG name: Membrane GTPase LepA
Functional Class:  N
The phylogenetic pattern of COG0481 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 12-27 and 82-113 represent significant (99%) hits to blocks
BL00301A,B, GTP-binding elongation factors proteins. Residues 9-48,
79-116, 136-190, 199-236, and 314-348 represent significant (98%)
hits to blocks BL01176A,B,C,D,G, Initiation factor 2 proteins.
Residues 11-32, 580-601, 70-92, 128-141, and 164-186 represent
significant (98%) hits to blocks PR00449A,C,D,E, TRANSFORMING
PROTEIN P21 RAS SIGNATURE. Residues 132-141 represent a significant
(97%) hit to block PR00318A, ALPHA G-PROTEIN (TRANSDUCIN) SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 82-226 are 57% similar to GTP-binding membrane protein of
LEPA_SYNY3, which is part of a family that includes translation
elongation factors. Residues 12-34, 299-456, 457-533, and 546-599
also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0767, TP0450, TP0187
all of which are translation elongation factors, and TP0891,
translation initiation factor 2. Residues 11-160 are 38% similar,
residues 168-378 are 23% similar and residues 405-478 are 33% similar
to TP0767. These same regions are 32%, 26%, and 27% similar to
TP0450. Residues 12-268 are 24% similar to TP0187 and residues
15-226 are 28% similar to TP0891.

Pfam Summary:  Pfam Search
Residues 8 to 190 (E-value = 1e-72) place TP0510 in the GTP_EFTU family which is described as Elongation factor Tu GTP binding domain (PF00009)
Residues 211 to 281 (E-value = 7.6e-11) place TP0510 in the GTP_EFTU_D2 family which is described as Elongation factor Tu domain 2 (PF03144)
Residues 404 to 493 (E-value = 1.2e-31) place TP0510 in the EFG_C family which is described as Elongation factor G C-terminus (PF00679)
Residues 494 to 602 (E-value = 9.9e-73) place TP0510 in the LepA_C family which is described as GTP-binding protein LepA C-terminus (PF06421)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
27  
56

PDB Hit:
none

Gene Protein Sequence:
MRAMACVRRVRNFCIVAHIDHGKSTLADRLIERTRAVEERLQHAQMTDNM
ELERERGITIKSHAVCIPYTDAHGTEYVLNFVDTPGHADFAYEVSRAIAA
CEGALLVVDATQGVESQTISNLYLVLEHNLEIIPVINKIDLPTADVPRVL
QQVEHDLGLDPASSVLISAKTGENVDALFDAIITRIPPPQGSGTAALQAL
VFDCHYDQYRGVVVHIRVFEGQVTSGMVIRFMSNGAEYRVEETGVFVFNL
IAREALCAGDVGYLSANVKTVSDVQVGDTITDASCPCDTPRAGFRRVKPV
VFSSVYPVDTDECEQLREALERLALNDASISWERDSSLALGHGFRCGFLG
LLHLEVVQQRLEREFNQTVIFTAPQVQYYVFLKTGQRIVCDNPAHYPLEQ
EIAQVHEPYIRATIITPTEVLGAVMTLCIEKRAYQTAVNYLDQKRVELVY
EMPLAEILFGFYDRLKSISHGYASFDYELIESKLTDLVKVDILINGKPVD
ALAQLCYRPHARRRAQAVCARLKEEISRQQFKIAIQGSIGGQIISRETVS
PFRKDVLAKCYGGDITRKRKLLEKQKEGKKRMKMVGDVEIPQTAFLSVLK
EASDA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGCGCCATGGCTTGCGTGCGCCGAGTGCGAAATTTCTGTATTGTCGC
GCACATTGACCACGGTAAATCCACCCTTGCTGACCGACTCATCGAAAGGA
CGCGCGCGGTAGAAGAGCGTCTGCAGCACGCGCAGATGACCGACAACATG
GAACTCGAGCGAGAACGAGGTATAACTATTAAAAGCCACGCCGTGTGTAT
TCCCTACACGGATGCACACGGCACCGAGTATGTGTTGAACTTTGTAGACA
CGCCGGGACACGCGGATTTTGCATACGAGGTGTCGCGCGCAATTGCTGCC
TGTGAGGGAGCGCTCCTGGTGGTAGATGCAACGCAGGGAGTTGAGTCGCA
GACGATCTCAAATCTCTACTTAGTTTTAGAGCACAATTTGGAAATTATCC
CTGTTATCAATAAGATCGACCTGCCTACGGCAGACGTGCCGCGTGTGCTC
CAACAGGTAGAGCACGACCTGGGCTTGGATCCCGCCTCTAGTGTGTTGAT
TTCTGCAAAAACGGGAGAGAATGTCGACGCGCTCTTTGATGCAATTATCA
CGCGTATTCCTCCCCCGCAGGGGAGTGGTACGGCCGCGCTCCAAGCGTTA
GTATTTGACTGTCACTATGACCAGTACCGCGGGGTAGTTGTCCACATTCG
TGTTTTCGAGGGACAAGTCACAAGTGGCATGGTTATTCGTTTCATGAGCA
ACGGGGCAGAGTACCGTGTAGAAGAGACGGGTGTCTTTGTATTCAACCTT
ATTGCACGTGAAGCGCTGTGTGCAGGAGATGTCGGTTACCTGAGTGCAAA
TGTAAAAACGGTTTCAGATGTACAGGTGGGGGATACCATCACAGACGCGT
CCTGCCCATGTGACACGCCGCGTGCTGGATTTAGACGGGTAAAGCCGGTG
GTCTTTTCCTCGGTGTATCCGGTGGACACTGATGAGTGTGAGCAACTGCG
CGAAGCATTGGAGCGACTTGCCCTCAACGACGCAAGTATTTCCTGGGAAC
GAGACTCATCCTTAGCGCTGGGGCACGGATTTCGCTGTGGTTTTCTAGGA
CTGCTTCATCTTGAAGTAGTGCAGCAGCGTTTAGAGCGAGAGTTCAACCA
GACAGTCATTTTTACTGCGCCTCAGGTGCAATACTATGTGTTTCTAAAAA
CGGGACAGCGCATAGTGTGTGACAACCCAGCCCATTATCCTTTGGAGCAG
GAGATTGCACAGGTGCATGAACCCTACATCCGTGCAACTATCATTACGCC
GACAGAGGTGCTCGGTGCTGTCATGACGCTCTGTATTGAAAAGCGCGCGT
ACCAAACAGCGGTGAACTATTTAGATCAGAAGCGGGTGGAACTGGTATAC
GAGATGCCCCTTGCGGAAATTCTCTTTGGGTTTTACGATAGGCTCAAGAG
TATTAGCCACGGCTATGCGTCTTTTGACTATGAGCTTATAGAGTCGAAGC
TCACAGATCTGGTGAAAGTTGACATCCTTATTAATGGGAAGCCGGTAGAC
GCGCTTGCGCAGTTGTGCTATCGACCGCATGCCCGCAGAAGGGCGCAGGC
GGTGTGTGCTCGCCTGAAAGAGGAGATTTCCCGTCAGCAGTTCAAGATTG
CAATCCAAGGCTCAATCGGCGGGCAGATTATCTCGCGCGAGACGGTTAGT
CCGTTCCGCAAAGATGTACTTGCTAAATGCTACGGAGGTGACATCACACG
TAAGCGAAAGTTGCTGGAGAAACAGAAGGAAGGGAAAAAGCGAATGAAGA
TGGTGGGGGATGTGGAGATCCCGCAGACTGCCTTCCTGTCGGTGCTAAAA
GAGGCTTCCGACGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy