Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-2 tRNA-Lys-1 tRNA-Leu-3 IGR367 IGR368 IGR369 IGR365 IGR366 IGR364 hxk, - TP0505 lepA, - TP0510 ahpC, - TP0509 ydeB, - TP0511 TP0512 clpX, - TP0508 tig, - TP0506 trkA, - TP0513 hxk, - TP0505 lepA, - TP0510 ahpC, - TP0509 ydeB, - TP0511 TP0512 clpX, - TP0508 tig, - TP0506 trkA, - TP0513 Type: tandem, Name:  - 115 Type: tandem, Name:  - 116 hxk, - TP0505 lepA, - TP0510 ahpC, - TP0509 ydeB, - TP0511 TP0512 clpX, - TP0508 tig, - TP0506 trkA, - TP0513 clpP, - TP0507 clpP, - TP0507
* Calculated from Protein Sequence

Gene ID: TP0509

DNA Molecule Name:
1  

Genbank ID:
3322801

Gene Name:
ahpC  

Definition:
alkyl hydroperoxide reductase, subunit C

Gene Start:
544394

Gene Stop:
544957

Gene Length:
564

Molecular Weight*:
20694

pI*:
6.92

Net Charge*:
-0.18

EC:
1.6.4.-  

Functional Class:
Cellular processes; Detoxification  

Pathway: pathway table

Secondary Evidence:
Poole LB.
Bacterial defenses against oxidants: mechanistic features of cysteine-based peroxidases and their flavoprotein reductases.
Arch Biochem Biophys. 2005 Jan;433(1):240-54.
PMID: 15581580

Johnson NA, Liu Y, Fletcher HM.
Alkyl hydroperoxide peroxidase subunit C (ahpC) protects against organic peroxides but does not affect the virulence of Porphyromonas gingivalis W83.
Oral Microbiol Immunol. 2004 Aug;19(4):233-9.
PMID: 15209993

Diaz PI, Zilm PS, Wasinger V, Corthals GL, Rogers AH.
Studies on NADH oxidase and alkyl hydroperoxide reductase produced by Porphyromonas gingivalis.
Oral Microbiol Immunol. 2004 Jun;19(3):137-43.
PMID: 15107063

Wood ZA, Schrder E, Robin Harris J, Poole LB.
Structure, mechanism and regulation of peroxiredoxins.
Trends Biochem Sci. 2003 Jan;28(1):32-40.
PMID: 12517450

Comment:


Blast Summary:  PSI-Blast Search
This sequence corresponds to 3322801 in Genbank.

Its nearest neighbor in the NR database is 18144442 from
Clostridium perfringens str. 13.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0450
COG name: Thiol - alkyl hydroperoxide reductases
Functional Class: O
The phylogenetic pattern of COG0450 is amtkYQvCeBR-uj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 22-100 are 54% simiar to alkyl hydroperoxide reductase of
AHPC_BACSU. Residues 36-110, 109-144 and 158-179 also support this
match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 5 to 152 (E-value = 1e-48) place TP0509 in the AhpC-TSA family which is described as AhpC/TSA family (PF00578)

PDB Hit:
none

Gene Protein Sequence:
MESLIGKRVIDFKLPAYVGGKFTEVSNASIKGSWAVFMFYPADFTFVCPT
ELADLARVYPSFVEIGCKVYSVSTDSEYVHKAWADATDTIKNLPYEMISD
KAGKLAGFFGVLLPDTWHALRGTFVVDPEGLVKAFEVHDMGIGRDADELL
RKVQSAQFVAKHGDQVCPARWKPGAKTLKPGIDLIGKI

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGAGTCTCATAGGCAAGAGGGTTATAGACTTTAAGCTTCCTGCGTA
TGTCGGGGGGAAGTTTACGGAGGTCTCTAACGCATCCATTAAGGGTAGCT
GGGCGGTGTTTATGTTTTACCCGGCCGACTTCACCTTTGTGTGCCCCACC
GAGCTTGCGGATCTCGCGCGCGTATATCCGTCTTTTGTGGAGATTGGTTG
TAAGGTATATTCGGTTTCTACGGACAGTGAGTACGTGCACAAGGCATGGG
CGGATGCGACAGACACGATAAAGAATCTGCCCTACGAGATGATTTCTGAC
AAGGCGGGAAAGCTTGCGGGTTTCTTTGGAGTGTTGTTGCCAGACACTTG
GCATGCGCTGCGGGGTACGTTCGTGGTCGATCCTGAAGGCCTTGTGAAAG
CTTTCGAGGTACACGACATGGGTATTGGGCGCGATGCGGATGAGCTTTTG
CGCAAGGTTCAGTCAGCACAGTTTGTGGCTAAGCATGGGGATCAGGTTTG
TCCTGCTCGTTGGAAGCCTGGAGCAAAGACGTTGAAGCCTGGTATTGATT
TAATCGGTAAGATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy