Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-2 tRNA-Lys-1 tRNA-Leu-3 IGR363 IGR367 IGR368 IGR365 IGR366 IGR364 hxk, - TP0505 lepA, - TP0510 TP0503 ahpC, - TP0509 ydeB, - TP0511 TP0512 clpX, - TP0508 tig, - TP0506 hxk, - TP0505 lepA, - TP0510 TP0503 ahpC, - TP0509 ydeB, - TP0511 TP0512 clpX, - TP0508 tig, - TP0506 Type: tandem, Name:  - 115 hxk, - TP0505 lepA, - TP0510 ahpC, - TP0509 ydeB, - TP0511 TP0512 clpX, - TP0508 tig, - TP0506 TP0504 clpP, - TP0507 clpP, - TP0507 TP0503 TP0504
* Calculated from Protein Sequence

Gene ID: TP0508

DNA Molecule Name:
1  

Genbank ID:
3322800

Gene Name:
clpX  

Definition:
ATP-dependent Clp protease subunit X

Gene Start:
543050

Gene Stop:
544294

Gene Length:
1245

Molecular Weight*:
45466

pI*:
7.56

Net Charge*:
1.62

EC:
3.4.21.92  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Potocka I, Thein M, ØSterås M, Jenal U, Alley MR.
Degradation of a Caulobacter soluble cytoplasmic chemoreceptor is ClpX dependent.
J Bacteriol. 2002 Dec;184(23):6635-41.
PMID: 12426352

Periago PM, Abee T, Wouters JA.
Analysis of the heat-adaptive response of psychrotrophic Bacillus weihenstephanensis.
Int J Food Microbiol. 2002 Nov;79(1-2):17-26.
PMID: 12382681

Burger A, Raymer J, Bockrath R.
DNA damage-processing in E. coli: on-going protein synthesis is required for fixation of UV-induced lethality and mutation.
DNA Repair (Amst). 2002 Oct;1(10):821-31.
PMID: 12531029


Comment:
This protein is the ATP-dependent specificity component of the ClpP
protease. It can also perform chaperone functions in the absence of
ClpP.

See TP0549 (clpC), TP0801 (clpA), TP0507 (clpP),
TP1041 (clpP), TP0071 (clpB).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to ATP-dependent
protease ATPase subunit clpX proteins. For example residues 7-399
are 56% similar to CLPX_HAEIN, ATP-dependent proteinase clpX
of Haemophilus influenzae,(U32754).

COGS Summary:  COGS Search
BeTs to 12 clades of COG1219
COG name: ATP-dependent protease Clp, ATPase subunit ClpX
Functional Class:? O
The phylogenetic pattern of COG1219 is ----yqvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 110-131, 155-191, 146-191, and 150-170 represent significant
(98%) hits to blocks BL00674B,C,D,E, AAA-protein family proteins.
Residues

ProDom Summary:  Protein Domain Search
Residues 150-394 are 57% similar to ATP-dependent Clp protease subunit
X of CLPX_HAEIN. Residues 12-34 and 64-96 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0801, ATP-dependent Clp
protease subunit A, TP0071, ATP-dependent Clp protease subunit B,
TP0765, cell division protein FtsH, TP0549, ATPase ClpC, and
TP0162, Holliday junction DNA helicase (ruvB). Residues 111-396
are 23% similar to TP0801, and residues 37-380 are 22% similar to
TP0071, residues 113-212 are 31% similar to TP0765. Residues
114-374 are 23% similar and residues 48-184 are 27% similar to
TP0549. Residues 49-194 are 28% similar to TP0162.

Pfam Summary:  Pfam Search
Residues 12 to 48 (E-value = 1.7e-18) place TP0508 in the zf-C4_ClpX family which is described as ClpX C4-type zinc finger (PF06689)
Residues 112 to 331 (E-value = 2.4e-25) place TP0508 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
284  
415

PDB Hit:
none

Gene Protein Sequence:
MLRSKGDLVLGCSFCGKKEDERRRIVTGHGVSICNYCVERCAEYLRDRKP
SALALMTKEEIPTPLELKAYLDQYVIGQDLAKRVLSVAVYNHYKRVAGRS
LDIDSVLIEKSNVLLIGPTGSGKTLLAKTLSQKMKVPFAIADATTLTEAG
YVGEDVENILLKLVQNANGDVALAERGIIFIDEIDKISRKSENVSITRDV
SGEGVQQALLKIIEGTIASVPPQGGRKHPNQDMLRVDTSNILFICGGAFV
GLDGIVGTRVCKNPVGFGADVKTVKERGLQLMHEDVIPDDLVKFGLIPEI
IGRLPVTVALDALSKEDLRNILVRPRNAIVRQFEALFALDDVRLVFDEDA
LDAIAQQAIDQKTGARGLRSIVERLMLDAMFEAPSLKGKKELCITKKVVT
QEEKASVRLVSERTA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCAGGTCTAAGGGGGATCTGGTATTGGGCTGCTCTTTCTGTGGAAA
AAAAGAAGATGAGCGACGCCGGATTGTGACCGGTCATGGGGTTTCTATTT
GCAATTATTGTGTGGAGCGGTGTGCAGAATACTTGCGTGATCGCAAGCCG
TCGGCACTTGCGCTCATGACCAAAGAGGAGATTCCAACTCCTTTAGAGTT
GAAAGCTTACCTTGATCAGTACGTTATTGGGCAGGATTTGGCCAAGCGGG
TGCTATCGGTTGCGGTGTACAACCACTACAAACGGGTGGCAGGTAGGTCT
TTGGATATTGATTCGGTATTGATTGAAAAATCTAACGTGCTGCTTATTGG
GCCGACAGGTTCAGGCAAAACGCTGTTGGCTAAGACACTTTCTCAGAAAA
TGAAGGTCCCCTTTGCGATAGCAGATGCTACTACGCTCACCGAGGCCGGT
TATGTGGGTGAGGACGTAGAGAATATCTTATTAAAGCTCGTTCAGAATGC
GAACGGAGATGTTGCCCTCGCAGAACGGGGGATTATCTTCATTGATGAAA
TCGATAAGATTTCGCGTAAGAGCGAGAACGTGTCTATTACGCGTGATGTG
TCGGGTGAAGGGGTTCAGCAGGCGCTTTTGAAAATAATTGAGGGAACGAT
AGCATCGGTGCCTCCGCAGGGGGGTCGCAAGCATCCAAACCAAGACATGC
TCAGGGTGGATACATCGAACATTTTGTTCATCTGTGGTGGTGCGTTCGTT
GGGTTAGATGGTATTGTCGGTACGAGAGTGTGTAAGAATCCGGTTGGCTT
TGGAGCAGATGTAAAAACGGTAAAGGAGCGAGGTCTGCAACTGATGCACG
AGGACGTCATTCCGGATGATTTGGTGAAATTTGGATTAATCCCAGAGATT
ATCGGCCGTCTGCCGGTGACGGTCGCCTTGGATGCTCTTTCTAAAGAGGA
TCTGCGCAATATCTTGGTACGACCGCGAAATGCTATTGTCCGTCAGTTTG
AAGCGTTATTCGCGTTGGATGACGTGCGTCTTGTCTTTGATGAGGACGCT
TTGGACGCAATAGCTCAGCAGGCAATTGATCAAAAAACGGGGGCGCGGGG
TTTGCGCTCTATTGTGGAAAGATTAATGCTTGATGCTATGTTTGAGGCAC
CGTCTCTGAAAGGGAAAAAGGAGCTATGCATTACGAAGAAGGTAGTTACA
CAAGAGGAAAAAGCCAGCGTTCGCCTTGTTTCTGAACGTACTGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy