Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-2 tRNA-Lys-1 tRNA-Leu-3 IGR363 IGR367 IGR368 IGR365 IGR366 IGR364 hxk, - TP0505 lepA, - TP0510 TP0504 ahpC, - TP0509 ydeB, - TP0511 TP0502 TP0512 clpX, - TP0508 tig, - TP0506 hxk, - TP0505 lepA, - TP0510 TP0504 ahpC, - TP0509 ydeB, - TP0511 TP0502 TP0512 clpX, - TP0508 tig, - TP0506 Type: tandem, Name:  - 115 hxk, - TP0505 lepA, - TP0510 ahpC, - TP0509 TP0502 TP0512 clpX, - TP0508 tig, - TP0506 TP0503 clpP, - TP0507 clpP, - TP0507 TP0504 ydeB, - TP0511 TP0503
* Calculated from Protein Sequence

Gene ID: TP0507

DNA Molecule Name:
1  

Genbank ID:
3322799

Gene Name:
clpP  

Definition:
ATP-dependent Clp protease proteolytic component

Gene Start:
542452

Gene Stop:
543060

Gene Length:
609

Molecular Weight*:
22331

pI*:
5.35

Net Charge*:
-4.99

EC:
3.4.21.92  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Viala J, Mazodier P.
The ATPase ClpX is conditionally involved in the morphological differentiation of Streptomyces lividans.
Mol Genet Genomics. 2003 Feb;268(5):563-9.
PMID: 12589431

Fedhila S, Msadek T, Nel P, Lereclus D.
Distinct clpP genes control specific adaptive responses in Bacillus thuringiensis.
J Bacteriol. 2002 Oct;184(20):5554-62.
PMID: 12270812

Schelin J, Lindmark F, Clarke AK.
The clpP multigene family for the ATP-dependent Clp protease in the cyanobacterium Synechococcus.
Microbiology. 2002 Jul;148(Pt 7):2255-65.
PMID: 12101312

Clarke AK, Schelin J, Porankiewicz J.
Inactivation of the clpP1 gene for the proteolytic subunit of the ATP-dependent Clp protease in the cyanobacterium Synechococcus limits growth and light acclimation.
Plant Mol Biol. 1998 Jul;37(5):791-801.
PMID: 9678574

Comment:
In E. coli, this protein cleaves peptides in various proteins in a
process that requires ATP hydrolysis. It has chymotrypsin-like
activity and may be responsible for a fairly general and central
housekeeping function rather than for the degradation of specific
substrates. ClpP may play the role of a master protease which is
attracted to different substrates by different specificity factors
such as ClpA or ClpX. It is induced by heat shock.

There is a 3D structure known for the E. coli protein.

See TP0549 (clpC), TP0801 (clpA), TP0508 (clpX),
TP1041 (clpP), TP0071 (clpB).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to ATP-dependent Clp
protease proteolytic subunit. For example residues 2-199 are 61%
similar to ATP-dependent Clp protease proteolytic subunit of Aquifex
aeolicus,(AE000735).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0740
COG name: Protease subunits of ATP-dependent proteases, ClpP family
Functional Class:? O
The phylogenetic pattern of COG0740 is -----qvCebRhuj--OLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 24-56, 79-130, and 151-194 represent significant (100%) hits
to blocks BL00381A,B,C, Endopeptidase Clp serine proteins.

ProDom Summary:  Protein Domain Search
Residues 24-194 are 62% similar to Clp protease of CLPP_ECOLI.

Paralogs:  Local Blast Search
This protein is paralogously related to TP1041, ATP-dependent Clp
protease proteolytic component. Residues 26-198 are 36% similar to
TP01092.

Pfam Summary:  Pfam Search
Residues 17 to 198 (E-value = 2.6e-123) place TP0507 in the CLP_protease family which is described as Clp protease (PF00574)

PDB Hit:
none

Gene Protein Sequence:
MRERMHNLVPYVIEQSGGGERSYDIFSRLLKDRIIFVDGEITDAVADLVV
AQLLFLESQNPDKDISLYINSPGGAVTAGLAVYDTMQHICPEVQTICLGQ
ASSMAAVLLAGGAPGKRFALPSSRVMIHQPWGGVQGQASDVCIQAQEILR
LKTLTIAYFALHTGQSEEQVREDMERDFFLSAEQACSYGIVDTVMKRRKH
AQV

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGTGAACGTATGCATAATCTGGTTCCCTACGTGATTGAACAGTCGGG
GGGTGGAGAGCGGAGCTATGACATTTTTTCCCGCTTGTTGAAGGACCGTA
TTATTTTCGTAGACGGGGAGATCACTGACGCGGTGGCGGATTTAGTTGTA
GCGCAGTTACTTTTTCTAGAGTCTCAGAATCCAGATAAGGATATCAGCCT
GTACATTAATAGTCCTGGCGGGGCGGTTACTGCAGGGCTTGCAGTGTACG
ATACGATGCAGCACATTTGCCCTGAGGTGCAGACCATTTGCTTAGGACAG
GCTTCGAGTATGGCAGCAGTGTTACTGGCAGGAGGTGCGCCTGGCAAGCG
TTTTGCGCTTCCGTCTTCTCGGGTGATGATCCATCAACCGTGGGGTGGCG
TACAGGGGCAGGCAAGTGATGTGTGCATCCAGGCGCAGGAGATCCTGCGC
CTAAAGACGCTGACGATTGCGTATTTCGCGTTGCACACTGGGCAGTCAGA
GGAGCAGGTGCGGGAGGATATGGAGCGAGATTTCTTCCTTTCCGCGGAGC
AGGCGTGTTCGTATGGTATCGTAGATACGGTAATGAAGAGGAGAAAGCAT
GCTCAGGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy