Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-2 tRNA-Lys-1 tRNA-Leu-3 IGR363 IGR362 IGR365 IGR364 hxk, - TP0505 TP0504 ahpC, - TP0509 TP0502 clpX, - TP0508 mreA,rodA, - TP0501 tig, - TP0506 pbp, - TP0500 hxk, - TP0505 TP0504 ahpC, - TP0509 TP0502 clpX, - TP0508 mreA,rodA, - TP0501 tig, - TP0506 pbp, - TP0500 Type: tandem, Name:  - 114 Type: tandem, Name:  - 115 hxk, - TP0505 ahpC, - TP0509 TP0502 clpX, - TP0508 mreA,rodA, - TP0501 tig, - TP0506 pbp, - TP0500 TP0503 clpP, - TP0507 clpP, - TP0507 TP0504 TP0503
* Calculated from Protein Sequence

Gene ID: TP0505

DNA Molecule Name:
1  

Genbank ID:
3322792

Gene Name:
hxk  

Definition:
hexokinase

Gene Start:
540396

Gene Stop:
539065

Gene Length:
1332

Molecular Weight*:
47833

pI*:
6.43

Net Charge*:
-3.19

EC:
2.7.1.1  

Functional Class:
Energy metabolism; Glycolysis  

Pathway: pathway table
Carbohydrate metabolism; Fructose and mannose metabolism
Carbohydrate metabolism; Glycolysis / Gluconeogenesis
Metabolism of complex carbohydrates; Starch and sucrose metabolism
Nucleotide metabolism; Aminosugars metabolism

Comment:
Reaction:
ATP + D-HEXOSE = ADP + D-HEXOSE 6-PHOSPHATE.

A 3D structure is known for the yeast protein.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the N-terminal and middle had several significant
hits to hexokinases. For example residues 58-307 are 28% similar to
HXK1_SCHPO, hexokinase 1 of Schizosaccharomyces pombe,(X92894).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
Residues 13-42, 56-92, 136-174, 200-243, and 264-309 represent
significant (99%) hits to blocks BL00378A,B,C,D,F, Hexokinases proteins.

ProDom Summary:  Protein Domain Search
Residues 58-307 are 29% similar to hexokinase of HXK1_SCHPO. Residues
387-439 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 5 to 209 (E-value = 8.2e-10) place TP0505 in the Hexokinase_1 family which is described as Hexokinase (PF00349)
Residues 216 to 439 (E-value = 6.2e-07) place TP0505 in the Hexokinase_2 family which is described as Hexokinase (PF03727)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
203  
224
non-globular  
284  
349
transmembrane  
354  
377

PDB Hit:
gi|809431|pdb|1GLK| Glucokinase (Atp:d-Hexose 6-Phosphotransferase) (E.C.2.7.1.1) (Theoretical Model)

Gene Protein Sequence:
MDQHTRTRDLVSAFFGRFHFDVQGPSVRTVVDVLRADMVRGLEEEAQLPP
RMGSALAMIPTWVAPPRVSPCNRRVIVIDAGGTNFRSCLVRFGDSGTPHI
ENLEKRPMPGTTREYSRTEFFGEIADNLARLKGAADCIGFCFSYPIRIRP
DGDGEVIQFAKEIKAAEVIGTCVGAGLTEALSARNWPELRSLKMLNDATS
ALLAGFFAAPEGCSFSSYVGFILGTGMNSAYLEPDPIPKIPAHHTPQVVV
CESGKSNKVPRSVFDELFTQTTAEPDIAHLEKMSSGTYLGPLASVVVRLA
AQEGLFSHAVHAALSTVSFTLVDMDRFLFAPSVSTTTLGALLAPGTDTDR
EILFLLLDAVVARAARIAAGVIAASVLKSGAGYDPLRPVCVLAEGTTFQR
TYRLRTRVTSHLQAFLTEERGVYFDIISLENAVTLGSALGGLSS

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATCAGCATACACGTACACGCGATCTTGTTTCTGCATTTTTTGGGCG
CTTTCACTTTGATGTCCAGGGACCTTCCGTCCGCACGGTTGTCGACGTGT
TGCGCGCAGATATGGTGCGCGGCTTAGAGGAAGAGGCGCAGCTTCCTCCC
CGTATGGGGAGTGCACTTGCGATGATTCCCACTTGGGTGGCGCCCCCCCG
TGTATCCCCCTGCAACCGACGCGTGATAGTTATCGACGCTGGAGGAACCA
ACTTTCGCTCGTGCCTCGTACGCTTCGGCGACAGTGGCACACCTCACATC
GAGAATTTAGAAAAACGTCCCATGCCCGGTACCACCCGTGAGTACTCAAG
GACAGAGTTTTTTGGAGAAATTGCAGACAACCTGGCACGTCTGAAAGGTG
CAGCGGACTGCATTGGCTTTTGTTTCTCTTACCCTATTCGTATCAGACCT
GACGGTGACGGTGAGGTTATTCAGTTTGCGAAGGAAATCAAAGCTGCTGA
GGTCATCGGCACGTGTGTCGGTGCTGGTTTGACAGAAGCGCTAAGTGCTC
GGAACTGGCCTGAACTCCGTTCTCTCAAAATGCTCAATGACGCAACGAGT
GCGCTGCTTGCAGGTTTTTTTGCGGCACCAGAGGGGTGTTCGTTCAGTTC
ATACGTAGGTTTTATTCTTGGCACTGGAATGAATTCTGCGTATCTGGAGC
CAGACCCTATTCCTAAAATTCCTGCGCATCACACACCTCAGGTGGTAGTG
TGCGAATCGGGAAAAAGCAACAAAGTACCGCGCAGTGTCTTTGACGAATT
ATTCACTCAAACTACTGCCGAGCCGGATATTGCACACCTAGAGAAGATGT
CCTCGGGCACCTACCTCGGTCCCCTTGCTTCCGTTGTCGTGCGGCTTGCG
GCACAAGAAGGTCTTTTCTCACACGCAGTACACGCTGCACTCAGTACGGT
TTCCTTTACACTCGTGGATATGGATCGTTTTTTATTTGCTCCCTCTGTGT
CCACCACCACGTTGGGCGCGTTGCTCGCACCGGGCACCGACACAGACCGA
GAGATTCTCTTTCTTTTGCTCGATGCGGTAGTTGCACGTGCAGCACGCAT
CGCTGCGGGAGTAATCGCCGCCTCAGTATTAAAAAGCGGTGCTGGGTATG
ATCCGCTTCGTCCCGTGTGCGTGCTCGCAGAAGGCACCACGTTCCAACGC
ACCTACCGCCTACGCACCCGGGTTACTTCCCACCTGCAAGCCTTTTTGAC
TGAGGAGCGCGGTGTGTATTTCGATATCATTTCACTTGAAAACGCCGTAA
CGCTCGGCTCTGCACTCGGAGGACTCAGTTCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy