Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Thr-2 tRNA-Tyr-1 IGR355 IGR357 IGR359 IGR356 IGR358 IGR354 TP0495 TP0490 TP0494 TP0489 TP0496 mreB, - TP0497 TP0491 dnaG, - TP0492 rpoD, - TP0493 mcp-2, - TP0488 TP0495 TP0490 TP0494 TP0489 TP0496 mreB, - TP0497 TP0491 dnaG, - TP0492 rpoD, - TP0493 mcp-2, - TP0488 Type: tandem, Name:  - 109 Type: tandem, Name:  - 110 Type: tandem, Name:  - 253 TP0495 TP0494 TP0489 mreB, - TP0497 TP0491 dnaG, - TP0492 rpoD, - TP0493 mcp-2, - TP0488 TP0490 TP0496
* Calculated from Protein Sequence

Gene ID: TP0492

DNA Molecule Name:
1  

Genbank ID:
3322781

Gene Name:
dnaG  

Definition:
DNA primase

Gene Start:
526077

Gene Stop:
527891

Gene Length:
1815

Molecular Weight*:
67885

pI*:
7.72

Net Charge*:
6.97

EC:
2.7.7.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Metabolism of cofactors, vitamins, and other substances; Ubiquinone biosynthesis

Secondary Evidence:
Zhang Y, Yang F, Kao YC, Kurilla MG, Pompliano DL, Dicker IB.
Homogenous assays for Escherichia coli DnaB-stimulated DnaG primase and DnaB helicase and their use in screening for chemical inhibitors.
Anal Biochem. 2002 May;304(2):174-9.
PMID: 12009693

Chang P, Marians KJ.
Identification of a region of Escherichia coli DnaB required for functional interaction with DnaG at the replication fork.
J Biol Chem. 2000 Aug;275(34):26187-95.
PMID: 10833513

Keck JL, Roche DD, Lynch AS, Berger JM.
Structure of the RNA polymerase domain of E. coli primase.
Science. 2000 Mar;287(5462):2482-6.
PMID: 10741967

Bird LE, Pan H, Soultanas P, Wigley DB.
Mapping protein-protein interactions within a stable complex of DNA primase and DnaB helicase from Bacillus stearothermophilus.
Biochemistry. 2000 Jan;39(1):171-82.
PMID: 106254

Comment:
DnaG signifies the leftmost boundary of a short region with high synteny to T.denticola; the mreA (rodA) gene at TP0501 marks the rightmost boundary.

DNA primase is the polymerase that synthesizes small RNA primers for
the Okazaki fragments on both template strands at replication forks
during chromosomal DNA synthesis.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the N-terminal and middle region had several
significant hits to DNA primases. For example residues 1-421 are 32%
similar to PRIM_LISMO, DNA primase of Listeria monocytogenes,(U13165).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0358
COG name: DNA primase (bacterial type)
Functional Class:? L
The phylogenetic pattern of COG0358 is amtk-qvcebrhujGPolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 547-563 and 586-603 represent significant (95%) hits to blocks
PR00041D,F, CAMP RESPONSE ELEMENT BINDING (CREB) PROTEIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 28-332 are 33% similar to DNA primase of PRIM_BACSU. Residues
522-557 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 4 to 101 (E-value = 3.8e-62) place TP0492 in the zf-CHC2 family which is described as CHC2 zinc finger (PF01807)
Residues 257 to 336 (E-value = 3.5e-23) place TP0492 in the Toprim family which is described as Toprim domain (PF01751)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
523  
605

PDB Hit:
none

Gene Protein Sequence:
MARISAHVIDAIADRVDLVSLVGNYTHLERRGDDWWGRCPFHHERTPSFH
VVPDKKMYYCFGCGVGGSTIKFFMEIEKIDFHEAAVRLAKRAGIEMSFED
GVHAPSAHASFTMQLCEVYQRIAETFHHVLMHTAQGARARAYLASRKVTD
DSIRTFKLGYAPPDPVWLFQFLRHKGYSPEFLARSGLFAKKSERIAVFSD
RIMYPIADRYGQVIAFGARALGTAPAKYLNTADMPQYKKGEHLFAFHCAL
SQMRKTRAAIICEGYMDVIAFHQAQLTYAVAPLGALLTKSQARLMRSFVD
RIYMCFDADGAGRAATYKAILLCRSLGFEVRIVELNGGTDPAECACIEGE
DALRKSVERSTTDAQYLIRCARHEHSHLGADDTSRAVSFLFPYLSVLDSA
IQREQVMQDIAMAFGIRIQAVHADYLRYVSRTTQKGTTGNCVLSVQGTAI
QVKEPATGVRTAQLRLVLAVVANPELFELLRESVCADDFEDPMAKELFII
LEECYRADTRASPHVLSCCTTDELRKLVSEAIVCGEFSCNAPQIVRDGVA
LVRRNRLLKERESLVGRLRRFGDASSGEECGSMQELMMEKQRVDEELERL
KGV

Gene Nucleotide Sequence:  Sequence Viewer
GTGGCTCGGATTTCTGCGCACGTTATTGATGCGATTGCTGATCGTGTGGA
TTTGGTTTCGCTGGTGGGAAATTACACGCATCTGGAGCGGCGTGGGGATG
ACTGGTGGGGTCGCTGTCCATTTCATCATGAGCGTACGCCTTCGTTTCAT
GTGGTGCCGGATAAAAAGATGTACTATTGCTTTGGGTGTGGGGTTGGTGG
ATCCACTATTAAGTTTTTTATGGAAATCGAGAAAATTGATTTCCACGAAG
CGGCAGTGCGTCTTGCAAAGCGTGCAGGAATCGAGATGTCCTTTGAGGAC
GGGGTGCACGCTCCTTCTGCTCATGCTTCCTTTACAATGCAGCTGTGTGA
AGTGTATCAGCGCATTGCAGAGACGTTCCATCACGTACTTATGCACACCG
CGCAAGGAGCGCGTGCGCGCGCGTACCTAGCCTCGCGCAAGGTAACGGAT
GATTCAATACGCACCTTTAAGCTCGGGTACGCTCCGCCGGATCCGGTATG
GTTGTTTCAATTTTTAAGGCACAAGGGATACTCCCCCGAGTTTCTGGCCC
GTTCTGGGTTGTTTGCAAAAAAAAGCGAGCGTATCGCCGTTTTTTCAGAT
CGGATCATGTATCCGATTGCCGACCGCTACGGTCAGGTTATCGCATTCGG
AGCGCGCGCCTTGGGGACTGCACCTGCAAAGTATTTGAACACGGCAGATA
TGCCACAGTATAAAAAGGGTGAGCACTTGTTTGCGTTTCACTGTGCTCTT
TCTCAGATGAGAAAGACGCGCGCGGCGATTATATGTGAAGGATACATGGA
TGTTATCGCGTTTCATCAGGCGCAGTTGACGTATGCTGTTGCGCCTTTAG
GCGCATTGCTGACGAAAAGCCAGGCACGTTTGATGCGTTCGTTTGTCGAT
CGAATATATATGTGTTTTGATGCCGACGGAGCAGGCAGAGCGGCAACGTA
CAAGGCGATTTTGTTGTGTCGTTCCTTGGGTTTTGAGGTACGGATAGTAG
AATTGAATGGAGGTACTGATCCTGCAGAATGTGCGTGTATAGAAGGAGAG
GACGCTTTGAGAAAAAGCGTAGAACGGAGCACTACTGACGCGCAGTATTT
GATACGGTGTGCACGCCATGAGCACAGTCACCTTGGTGCAGATGACACAT
CACGTGCGGTGTCCTTTTTATTCCCTTATCTGAGTGTCTTGGACTCTGCC
ATTCAGCGTGAGCAAGTCATGCAGGATATTGCGATGGCGTTTGGCATTCG
CATACAGGCGGTGCACGCAGATTACCTGCGTTATGTGTCCCGTACCACGC
AGAAAGGGACAACAGGGAATTGTGTTCTGTCTGTACAGGGAACAGCGATA
CAGGTGAAGGAGCCTGCTACGGGAGTACGCACTGCGCAGCTGCGTTTGGT
ACTAGCGGTGGTAGCAAATCCTGAGTTATTTGAGCTCCTGCGGGAGAGTG
TGTGTGCAGATGACTTTGAAGATCCTATGGCAAAAGAGTTATTCATAATC
CTAGAGGAGTGTTATCGTGCAGACACGCGTGCAAGTCCGCATGTTCTTTC
GTGTTGTACAACCGACGAGTTAAGGAAACTCGTGAGCGAGGCAATTGTCT
GTGGTGAGTTCTCTTGCAATGCGCCGCAGATTGTGCGTGACGGTGTTGCG
CTCGTGCGTCGTAATAGACTGCTGAAGGAGCGAGAATCGCTCGTAGGGCG
GCTGCGCCGATTTGGGGATGCATCTTCGGGTGAGGAGTGCGGGTCTATGC
AGGAGCTTATGATGGAAAAGCAGCGGGTTGATGAGGAGTTAGAAAGGTTG
AAAGGGGTGAGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy