Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR350 IGR352 IGR351 IGR353 TP0486 TP0487 TP0484 TP0481 mcp-2, - TP0488 TP0486 TP0487 TP0484 TP0481 mcp-2, - TP0488 Type: tandem, Name:  - 108 Type: tandem, Name:  - 105 Type: tandem, Name:  - 106 Type: tandem, Name:  - 107 TP0486 TP0487 TP0484 TP0483 cyaA, - TP0485 TP0483 cyaA, - TP0485 mcp-2, - TP0488 TP0482 TP0481 TP0482
* Calculated from Protein Sequence

Gene ID: TP0485

DNA Molecule Name:
1  

Genbank ID:
3322767

Gene Name:
cyaA  

Definition:
possible adenylate cyclase

Gene Start:
517388

Gene Stop:
515547

Gene Length:
1842

Molecular Weight*:
67022

pI*:
7.06

Net Charge*:
0.21

EC:
4.6.1.1  

Functional Class:
Regulatory functions  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Guermonprez P, Fayolle C, Rojas MJ, Rescigno M, Ladant D, Leclerc C.
In vivo receptor-mediated delivery of a recombinant invasive bacterial toxoid to CD11c + CD8 alpha -CD11bhigh dendritic cells.
Eur J Immunol. 2002 Nov;32(11):3071-81.
PMID: 12385027

Kimura Y, Mishima Y, Nakano H, Takegawa K.
An adenylyl cyclase, CyaA, of Myxococcus xanthus functions in signal transduction during osmotic stress.
J Bacteriol. 2002 Jul;184(13):3578-85.
PMID: 12057952

Hormozi K, Parton R, Coote J.
Toxicity tests on native and recombinant Bordetella pertussis adenylate cyclase toxin preparations.
Dev Biol Stand. 1999;101:147-54.
PMID: 10566788

Ladant D, Ullmann A.
Bordatella pertussis adenylate cyclase: a toxin with multiple talents.
Trends Microbiol. 1999 Apr;7(4):172-6.
PMID: 10217833

Comment:
Reaction:
ATP = 3',5'-CYCLIC AMP + PYROPHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the C-terminal region had several hits to
adenylate cyclases. For example residues 356-578 are 40% similar
to adenylate cyclase of Anabaena sp.,(D89624).

COGS Summary:  COGS Search
BeTs to 3 clades of COG2114
COG name: Adenylate cyclase, family 3 (some proteins contain HAMP domain)
Functional Class:? T
The phylogenetic pattern of COG2114 is -------C--R------l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 311-358 represent significant (96%) hit to block BL00538A,
Bacterial chemotaxis sensory transducers proteins.

ProDom Summary:  Protein Domain Search
Residues 412-528 are 47% similar to adenylate cyclase of CYAA_STIAU.
Residues 394-460 and 291-394 also support this match. Residues 211-364
are 27% similar to a region of CPS_CLOTM, a PUTATIVE SENSORY TRANSDUCER
PROTEIN.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 289 to 358 (E-value = 1.1e-14) place TP0485 in the HAMP family which is described as HAMP domain (PF00672)
Residues 384 to 576 (E-value = 7.8e-32) place TP0485 in the Guanylate_cyc family which is described as Adenylate and Guanylate cyclase catalytic domain (PF00211)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
18  
42
transmembrane  
274  
294
transmembrane  
298  
317

PDB Hit:
none

Gene Protein Sequence:
MSRKNANQKIVWPLTTKLIGIISTVVVLATIAVTAMASWFFASSLHSNAE
LNNLAAAENFAAQIKGEFEAIATSAKSFVSLGLRSGARMHSRSALSKDFF
SFYPRIGYIGVGGVAELWNGDFFKKNQLRVADARRFLADNAQVISTLQTA
PATLNAAPWFKAQIIAIVAPFEVDGATRNVVVIFSADVVQHLLESGASSG
TMYAVTWAGNSLYHPEYSLNYSNINLQDSPVVRDLRESTQLTKQISFIGT
DNKRYFGAFAKQTFGKFAIVLETPMSVVYQAVYYAIILDGILTGMVLLAS
ILLVWFIAQSITRPILTLVGATHAISSGQFLLDIKPSSKDEIGLLTETFV
SMGRGLAERERMKEAFGKFVNRDIAEKAMKGELALGGERKTATIFFSDVR
SFTEMSEKLPPEDVVEFLNEYMSCMVDCIEQTGGVVDKFIGDAIMAIWGA
PVSLGSARLDALQSMKAVFLMRESLIQLNEKRVACSKPRIGIGCGVNTGS
CVAGQIGSSKRMEYTVIGDAVNTASRIEALNKPFGTDFLISENTYELVKD
MLIVEKMPPITVKGKREPLNVYAAINLKGHDGPQTLDELRALLSIEKPGL
SADPDFEEKKCEVI

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCAGAAAGAACGCGAATCAGAAAATTGTGTGGCCGCTTACGACGAA
ACTCATCGGTATTATCAGCACGGTGGTGGTGCTCGCCACCATTGCGGTTA
CGGCCATGGCTTCCTGGTTCTTCGCTTCGAGTCTGCACAGTAATGCTGAG
CTTAATAATCTTGCCGCTGCGGAGAACTTTGCTGCGCAAATCAAAGGGGA
ATTCGAAGCCATTGCCACAAGCGCCAAGTCCTTCGTTTCCCTTGGCCTCA
GAAGTGGCGCGCGCATGCACTCGCGGTCCGCACTTTCTAAAGATTTTTTT
TCCTTTTACCCGCGCATCGGCTACATCGGAGTCGGCGGTGTAGCCGAGCT
GTGGAACGGTGACTTCTTCAAGAAAAATCAGCTGCGGGTGGCAGACGCTC
GTCGCTTCCTAGCTGACAACGCACAGGTTATTTCCACACTTCAAACTGCC
CCAGCCACGCTCAACGCCGCCCCCTGGTTTAAAGCGCAGATCATTGCTAT
CGTCGCGCCCTTTGAAGTTGACGGCGCTACGCGTAACGTTGTGGTTATCT
TCTCAGCGGATGTCGTTCAGCACCTGCTAGAATCTGGAGCCTCCTCCGGA
ACCATGTATGCCGTCACCTGGGCGGGGAACTCCCTGTACCACCCGGAATA
CTCTCTCAATTACAGCAACATTAACTTGCAGGACTCGCCCGTTGTGCGCG
ATTTACGCGAATCTACACAGCTGACCAAACAAATCAGCTTCATCGGCACG
GACAACAAGCGCTACTTCGGCGCGTTCGCCAAGCAAACCTTTGGAAAGTT
CGCCATAGTCCTAGAAACGCCTATGAGTGTGGTGTACCAGGCAGTATATT
ACGCGATTATCCTCGACGGTATCCTCACCGGCATGGTGCTCCTCGCCTCT
ATCTTGCTTGTCTGGTTCATTGCGCAGTCTATCACCCGCCCTATCCTTAC
CCTCGTCGGCGCAACGCACGCTATCAGCTCAGGACAGTTCCTCCTGGATA
TCAAGCCTTCAAGCAAAGACGAAATTGGCCTCCTCACCGAAACATTCGTG
AGTATGGGGCGTGGTCTGGCAGAACGGGAACGCATGAAAGAAGCGTTTGG
CAAATTTGTAAATAGAGACATCGCAGAGAAGGCCATGAAGGGAGAGCTCG
CACTGGGAGGGGAACGGAAAACCGCTACCATTTTTTTCTCAGACGTGCGC
TCCTTTACTGAGATGTCGGAGAAGCTTCCCCCTGAGGACGTAGTAGAGTT
TCTCAACGAGTACATGAGCTGTATGGTAGACTGCATCGAGCAGACAGGCG
GCGTGGTGGACAAGTTTATTGGAGATGCGATTATGGCGATATGGGGAGCG
CCAGTTTCCCTCGGCTCTGCACGCTTAGACGCATTGCAGAGCATGAAAGC
GGTCTTCCTCATGCGCGAAAGCCTTATTCAACTGAACGAAAAGCGCGTCG
CATGCTCAAAGCCTCGCATTGGCATCGGATGCGGCGTAAACACAGGCTCC
TGCGTCGCAGGTCAAATCGGCTCTTCCAAACGTATGGAATACACCGTCAT
CGGAGACGCGGTGAACACCGCAAGCAGGATCGAAGCACTGAATAAGCCGT
TCGGCACTGACTTTCTTATCTCCGAAAACACATATGAGCTTGTTAAAGAT
ATGCTTATAGTGGAGAAAATGCCCCCCATAACGGTAAAAGGAAAACGAGA
ACCACTGAATGTGTACGCTGCTATCAATCTAAAGGGGCATGACGGACCGC
AGACGCTCGATGAGCTGCGTGCACTTCTTTCCATTGAAAAGCCGGGGCTT
TCTGCCGACCCTGACTTCGAAGAAAAGAAGTGTGAAGTTATC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy