Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR349 IGR346 IGR344 IGR345 IGR350 IGR347 IGR348 IGR343 TP0479 devB, - TP0477 TP0474 TP0483 ack, - TP0476 zwf, - TP0478 gpi, - TP0475 TP0480 TP0481 TP0479 devB, - TP0477 TP0474 TP0483 ack, - TP0476 zwf, - TP0478 gpi, - TP0475 TP0480 TP0481 Type: tandem, Name:  - 104 TP0479 devB, - TP0477 TP0474 TP0483 ack, - TP0476 zwf, - TP0478 gpi, - TP0475 TP0480 TP0481 TP0482 TP0482
* Calculated from Protein Sequence

Gene ID: TP0478

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
zwf  

Definition:
glucose-6-phosphate 1-dehydrogenase

Gene Start:
508831

Gene Stop:
507287

Gene Length:
1545

Molecular Weight*:
58022

pI*:
6.83

Net Charge*:
-1.68

EC:
1.1.1.49  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Carbohydrate metabolism; Pentose phosphate cycle

Comment:
This reaction is the first step in the pentose phosphate pathway.

Reaction:
D-GLUCOSE 6-PHOSPHATE + NADP(+) =
D-GLUCONO-DELTA-LACTONE 6-PHOSPHATE + NADPH.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to glucose-6-phosphate
1-dehydrogenase. For example residues 15-506 are 48% similar to
G6PD_HAEIN, glucose-6-phosphate 1-dehydrogenase of Haemophilus
influenzae, (U32737).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0364
COG name: Glucose-6-phosphate 1-dehydrogenase
Functional Class:  G
The phylogenetic pattern of COG0364 is ----yqvcebRhuj--olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 15-33, 122-134, 121-133, 155-183, 184-216, 222-265, 385-407,
430-464, and 478-491 represnet several significant hits to blocks
BL00069A,B,C,D,E,F,G,H, Glucose-6-phosphate dehydrogenase proteins.
In addition

ProDom Summary:  Protein Domain Search
Residues 19-495 are 51% similar to glucose-6-phosphate 1-dehydrogenase
of G6PD_ACTAC.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 8 to 199 (E-value = 2.1e-67) place TP0478 in the G6PD_N family which is described as Glucose-6-phosphate dehydrogenase, NAD binding domain (PF00479)
Residues 201 to 502 (E-value = 3.7e-145) place TP0478 in the G6PD_C family which is described as Glucose-6-phosphate dehydrogenase, C-terminal domain (PF02781)

PDB Hit:
gi|1421566|pdb|1DPG|A Leuconostoc mesenteroides

Gene Protein Sequence:
MGKISGSGTVAPHILVIFGASGDLAARKLIPSLWDLFEQELLPRTFGILG
AGRTALSTESFRARLAEAVTKHAVRTPHDPARLTEFLQKIHYFSFDPTDS
VAFADFATYVRTLDQSLHTEGNFIFYLATPPSLYETIPTQLAMHHLNREQ
GNFRRVVIEKPFGYNLETAQHLNASLRAHFQENQTYRIDHYLGKETVQNI
LVTRFANPLFEPTWNRTHIDYVEITASESLGVENRGGYYDQSGALRDMIQ
NHLLLLLGIIAMEAPAVVSSSRLRDEIVKVFDCLRPMGERDVMQHTVRAQ
YVAGKIRGVAVPGYLEESGVDPRSCTETFAALKCYIDNWRWMDVPFYLRT
GKRLPTGVTEVIVHYRTLPIALFEHIERPCAREGNALVIRIQPDEGIQLK
IDLKEPGAGFKTIPVSVDFQYSALTYSHLPSAYERLLLDCMNGDNTLYHR
DDAVESAWRFIDPILAAWKSNKSPLLTYPAGSWGPKAADDLIKGSAPRWH
HPSSTLLSDDFACRL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGGAAAATCAGTGGCAGCGGCACGGTCGCGCCGCACATCCTGGTTAT
CTTTGGCGCTTCAGGCGACCTTGCCGCGCGGAAGCTTATCCCCTCGCTTT
GGGATCTCTTTGAGCAAGAGCTCCTGCCCCGTACATTCGGTATACTCGGC
GCAGGGCGTACGGCTCTGTCTACAGAGTCTTTTCGCGCACGGCTTGCAGA
GGCGGTCACAAAGCATGCAGTGCGCACACCGCACGACCCGGCGCGCCTCA
CCGAATTCCTGCAGAAGATCCACTACTTCTCGTTCGATCCCACCGACTCT
GTCGCCTTTGCCGACTTTGCCACGTACGTGCGCACCCTCGACCAGTCGCT
GCACACCGAGGGCAACTTTATCTTCTATCTTGCCACTCCCCCTAGCCTGT
ACGAAACTATCCCCACGCAGCTTGCTATGCACCACTTGAACCGGGAACAG
GGTAATTTTCGCAGGGTAGTTATTGAAAAACCCTTTGGCTACAACCTAGA
AACCGCGCAGCACCTTAATGCGAGCTTGCGTGCCCACTTTCAGGAAAACC
AAACCTATCGCATCGATCACTATCTGGGTAAGGAAACGGTCCAAAACATC
CTGGTCACTCGCTTTGCCAATCCCCTTTTCGAGCCCACATGGAACCGGAC
CCATATCGATTACGTTGAAATTACTGCAAGCGAATCACTAGGTGTCGAAA
ACCGCGGCGGTTACTACGACCAGTCCGGTGCATTGCGCGATATGATCCAA
AACCACTTGTTACTCCTCTTGGGTATTATCGCGATGGAGGCGCCCGCCGT
CGTGAGTTCAAGTCGTCTACGGGATGAAATCGTAAAGGTCTTTGACTGCC
TGCGCCCTATGGGAGAACGCGACGTCATGCAGCATACGGTGCGTGCCCAA
TACGTCGCCGGCAAGATACGCGGTGTAGCCGTCCCCGGCTACCTTGAGGA
GTCAGGCGTTGACCCTCGCTCGTGCACTGAAACCTTTGCCGCACTCAAGT
GCTACATCGACAATTGGCGGTGGATGGACGTTCCCTTCTACCTGCGGACG
GGTAAGCGTTTGCCCACGGGCGTCACTGAGGTGATCGTCCATTACCGAAC
GCTCCCCATCGCGCTTTTCGAGCACATCGAACGCCCGTGCGCACGCGAGG
GCAACGCGCTTGTCATTCGCATTCAACCCGACGAAGGAATTCAGCTTAAA
ATCGACCTCAAAGAGCCCGGCGCGGGGTTCAAGACTATTCCCGTCAGTGT
TGATTTTCAGTATTCGGCTCTTACCTATTCGCACTTACCCAGCGCGTATG
AGCGGCTATTGCTTGACTGCATGAATGGAGACAACACGCTCTACCATCGA
GATGACGCGGTGGAGTCTGCATGGCGCTTCATAGATCCTATTCTTGCCGC
ATGGAAATCAAACAAGAGTCCTCTACTTACGTACCCTGCAGGAAGCTGGG
GTCCGAAGGCTGCAGACGACCTGATCAAAGGGAGTGCTCCACGGTGGCAT
CACCCCTCTTCTACGCTGCTCAGCGATGATTTTGCCTGCCGACTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy