Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR349 IGR346 IGR344 IGR342 IGR345 IGR347 IGR348 IGR343 TP0473 TP0479 devB, - TP0477 TP0474 ack, - TP0476 zwf, - TP0478 gpi, - TP0475 TP0480 TP0481 TP0473 TP0479 devB, - TP0477 TP0474 ack, - TP0476 zwf, - TP0478 gpi, - TP0475 TP0480 TP0481 Type: tandem, Name:  - 104 TP0473 TP0479 devB, - TP0477 TP0474 ack, - TP0476 zwf, - TP0478 gpi, - TP0475 TP0480 TP0481 TP0482 TP0482
* Calculated from Protein Sequence

Gene ID: TP0477

DNA Molecule Name:
1  

Genbank ID:
3322765

Gene Name:
devB  

Definition:
glucose-6-phosphate dehydrogenase isozyme

Gene Start:
507223

Gene Stop:
506501

Gene Length:
723

Molecular Weight*:
27257

pI*:
7.32

Net Charge*:
1.80

EC:
1.1.1.49  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Carbohydrate metabolism; Pentose phosphate cycle

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to glucose-6-P-
dehydrogenases. For example residues 70-222 are 37% similar to
DEVB_HAEIN, probable glucose-6-phosphate dehydrogenase isozyme
(devB) homolog of Haemophilus influenza,(U32737).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0363
COG name: Glucosamine-6-phosphate deaminase (Glucosamine-6-phosphate isomerase)
Functional Class:  G
The phylogenetic pattern of COG0363 is ----Y-vcEBrHuj--Olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 103-202 are 37% similar to DEVB_ANASP, a putative glucose-6-phosphate dehydrogenase isozyme

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MKKHIFEDARAIAAFLVSVFDSRLKTQEILWLALSGGSTPREIFRTWAHE
FRHHLDWKRLRFFWSDERCVPPTDAQSNFNMTHSALLEPLEINPDAVFRV
RGEDAPESACAAYSQEIEARLPRQRGVPCFDIILLGMGADGHTASIFPHE
IELWDHSGCCVVATHPDTGQKRVSFTGHLINNAHEIYVVVTGREKQDMLA
SVASDPHASVPLHAWTLPKRSGCWIPLLRGLYPRKQCKPTV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGAAGCATATTTTTGAGGATGCGCGTGCCATCGCGGCGTTCCTCGT
TTCGGTGTTTGATTCTCGGCTCAAAACACAAGAGATTCTCTGGTTGGCCC
TGTCGGGGGGTTCCACTCCAAGGGAGATTTTCAGAACTTGGGCGCACGAG
TTTCGACACCACCTTGATTGGAAGCGCCTCCGCTTCTTCTGGAGCGATGA
GCGTTGCGTACCCCCCACGGATGCGCAGAGTAACTTCAACATGACCCATA
GTGCGCTCCTTGAGCCTCTGGAAATAAATCCTGACGCGGTGTTTCGCGTC
AGGGGAGAAGACGCCCCGGAGAGCGCCTGCGCCGCATACTCACAGGAAAT
TGAAGCACGGCTCCCAAGACAGCGTGGCGTGCCGTGCTTTGATATTATAC
TCCTGGGTATGGGGGCGGATGGACACACCGCGTCTATTTTCCCTCATGAA
ATAGAGCTGTGGGACCACAGCGGCTGTTGCGTCGTGGCAACTCACCCAGA
CACCGGTCAGAAACGTGTGAGTTTCACTGGGCACCTTATCAATAATGCAC
ACGAAATCTACGTCGTAGTTACCGGGCGTGAAAAGCAGGACATGCTCGCG
TCAGTCGCGTCAGATCCCCACGCGTCCGTGCCCTTGCACGCGTGGACACT
GCCAAAGCGCAGTGGCTGCTGGATACCGCTGCTGCGGGGGCTATATCCGC
GTAAGCAGTGTAAGCCAACGGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy