Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR349 IGR346 IGR344 IGR342 IGR345 IGR347 IGR341 IGR348 IGR343 TP0473 TP0479 devB, - TP0477 TP0474 ack, - TP0476 zwf, - TP0478 gpi, - TP0475 uvrC, - TP0472 TP0480 TP0481 TP0473 TP0479 devB, - TP0477 TP0474 ack, - TP0476 zwf, - TP0478 gpi, - TP0475 uvrC, - TP0472 TP0480 TP0481 Type: tandem, Name:  - 104 TP0473 TP0479 devB, - TP0477 TP0474 ack, - TP0476 zwf, - TP0478 gpi, - TP0475 uvrC, - TP0472 TP0481 TP0480
* Calculated from Protein Sequence

Gene ID: TP0476

DNA Molecule Name:
1  

Genbank ID:
3322764

Gene Name:
ack  

Definition:
acetate kinase

Gene Start:
506431

Gene Stop:
505088

Gene Length:
1344

Molecular Weight*:
49185

pI*:
7.01

Net Charge*:
0.11

EC:
2.7.2.1  

Functional Class:
Central intermediary metabolism; Other  

Pathway: pathway table
Carbohydrate metabolism; Pyruvate metabolism

Secondary Evidence:
Zhou S, Causey TB, Hasona A, Shanmugam KT, Ingram LO.
Production of optically pure D-lactic acid in mineral salts medium by metabolically engineered Escherichia coli W3110.
Appl Environ Microbiol. 2003 Jan;69(1):399-407.
PMID: 12514021

Katayama A, Tsujii A, Wada A, Nishino T, Ishihama A.
Systematic search for zinc-binding proteins in Escherichia coli.
Eur J Biochem. 2002 May;269(9):2403-13.
PMID: 11985624

Yang YT, Aristidou AA, San KY, Bennett GN.
Metabolic flux analysis of Escherichia coli deficient in the acetate production pathway and expressing the Bacillus subtilis acetolactate synthase.
Metab Eng. 1999 Jan;1(1):26-34.
PMID: 10935752

Comment:
Ack is involved in the secretion of excess carbohydrate. It catalyzes
interconversion of acetate and acetyl phosphate and appears to favor
the formation of acetate.

Reaction:
ATP + ACETATE = ADP + ACETYL PHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to acetate kinases.
For example residues 3-399 are 43% similar to ACKA_BACSU, acetate kinase
of Bacillus subtilis,(L17320).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0282
COG name: Acetate kinase
Functional Class:? C
The phylogenetic pattern of COG0282 is ------VcEBrhujgpol--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 3-15, 87-96, 118-128, 144-165, 174-184, 205-247, 266-283,
324-337, and 381-396 represent significant (100%) hits to blocks
BL01075A,B,C,D,E,F,G,H,I, Acetate and butyrate kinases family proteins.

ProDom Summary:  Protein Domain Search
Residues 3-179 are 43% similar to acetate kinase of ACKA_CLOTS. Residues
180-335 and 341-401 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 2 to 394 (E-value = 3e-169) place TP0476 in the Acetate_kinase family which is described as Acetokinase family (PF00871)

PDB Hit:
none

Gene Protein Sequence:
MIILTLNCGSSSVKYQVYNWTERAVIAVGVVERVTQAGSVITHEVHGREN
HVRESPCPTHTEAVQLIISTLTDAHVGVISDMSLIKAVGHRVLHAADRFV
KSVVVTPDVLETFRSVQDLGPLHNPANIRGIEAAQAVIPSVPHCAIMDTA
WHQTMPEASFMYAVPRQWYEEYAVRRYGFHGTSFLYTAKRASVILKKRAE
DTNIIIAHIGNGASMCCVKNGVSFDTSMGITPLEGLIMGTRCGDCDPALA
FYIMRKTGMSVSDIDTTLNKQSGLLGITGKYVDRRDVCAAMKNGDALARL
AFDMEVHRIRKYFGAYVAALGKQPDALVFTAGVGEMCCDVRAAACAGLEH
LGIRLDARKNELARTRNAETEISTDDSPVRILVIPTDEELVMTEDTYALM
QGTYDVHTRFTYSFQDPTYVNKARAAGLKRDLEKNPALATIVVPRLDT

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTATCCTCACGCTAAACTGCGGCAGTTCATCTGTAAAATACCAGGT
GTATAACTGGACAGAGCGTGCGGTGATTGCCGTCGGCGTGGTAGAGCGTG
TTACTCAGGCAGGATCTGTTATCACGCATGAGGTGCACGGCCGAGAGAAC
CACGTTCGGGAAAGTCCCTGCCCTACCCATACCGAAGCGGTGCAGCTTAT
CATCAGCACCCTCACCGATGCGCACGTCGGTGTTATCAGCGACATGAGTC
TTATCAAGGCAGTTGGACACCGCGTCCTACACGCAGCAGATCGCTTTGTA
AAGTCTGTCGTTGTGACTCCTGACGTGCTAGAAACATTTCGCTCTGTTCA
AGACCTTGGCCCTCTCCACAACCCCGCAAACATCCGTGGTATTGAGGCTG
CCCAGGCGGTCATCCCCTCAGTTCCCCACTGTGCCATTATGGATACTGCG
TGGCATCAAACCATGCCAGAAGCTAGCTTCATGTACGCAGTGCCCCGGCA
GTGGTACGAAGAATACGCGGTACGTCGCTACGGCTTTCACGGCACGAGTT
TTCTTTATACTGCAAAGCGCGCCTCTGTCATTCTCAAAAAAAGGGCTGAG
GACACAAACATAATCATTGCGCATATTGGAAACGGCGCTTCCATGTGTTG
TGTCAAAAATGGTGTCAGCTTTGACACTTCCATGGGCATCACCCCGCTAG
AAGGCCTGATTATGGGAACACGCTGCGGGGACTGCGACCCTGCGCTTGCC
TTTTACATTATGAGAAAAACAGGCATGTCTGTCTCAGACATCGACACCAC
TCTCAATAAACAGTCCGGTTTGCTAGGCATCACCGGAAAATACGTGGACC
GACGCGATGTGTGTGCTGCCATGAAAAATGGAGACGCGCTTGCACGCCTT
GCCTTTGACATGGAGGTACACCGCATCCGGAAATACTTCGGCGCATACGT
TGCAGCTTTGGGTAAACAGCCGGACGCGCTTGTCTTTACCGCAGGTGTTG
GAGAGATGTGTTGCGACGTACGCGCAGCAGCGTGCGCAGGACTCGAACAC
CTAGGCATCCGACTTGATGCGCGAAAAAATGAACTGGCCCGCACGCGCAA
TGCAGAAACTGAAATTAGTACAGACGATTCACCCGTCCGCATTCTGGTAA
TCCCAACAGATGAAGAATTGGTCATGACTGAGGACACGTATGCACTCATG
CAGGGAACATACGACGTGCACACGCGTTTTACCTACTCGTTCCAGGATCC
AACCTATGTCAATAAGGCGCGGGCAGCAGGATTAAAAAGAGATTTAGAAA
AGAACCCGGCACTCGCGACGATTGTCGTGCCGCGTCTTGATACA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy