Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR340 IGR346 IGR344 IGR342 IGR345 IGR347 IGR341 IGR343 TP0473 TP0479 devB, - TP0477 TP0474 ack, - TP0476 zwf, - TP0478 gpi, - TP0475 uvrC, - TP0472 TP0471 TP0473 TP0479 devB, - TP0477 TP0474 ack, - TP0476 zwf, - TP0478 gpi, - TP0475 uvrC, - TP0472 TP0471 TP0473 TP0479 devB, - TP0477 TP0474 ack, - TP0476 zwf, - TP0478 gpi, - TP0475 uvrC, - TP0472 TP0471
* Calculated from Protein Sequence

Gene ID: TP0475

DNA Molecule Name:
1  

Genbank ID:
3322763

Gene Name:
gpi  

Definition:
glucose-6-phosphate isomerase

Gene Start:
505021

Gene Stop:
503417

Gene Length:
1605

Molecular Weight*:
58408

pI*:
7.06

Net Charge*:
0.51

EC:
5.3.1.9  

Functional Class:
Energy metabolism; Glycolysis  

Pathway: pathway table
Carbohydrate metabolism; Glycolysis / Gluconeogenesis
Carbohydrate metabolism; Pentose phosphate cycle
Metabolism of complex carbohydrates; Starch and sucrose metabolism

Comment:
This protein is involved in glycolysis and in gluconeogenesis.

Reaction:
GLUCOSE 6-PHOSPHATE = FRUCTOSE 6-PHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to glucose-6-phosphate
isomerases. For example residues 1-515 are 45% similar to glucose-6-
phosphate isomerase of Borrelia burgdorferi,(AE001173).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0166
COG name: Glucose-6-phosphate isomerase
Functional Class:  G
The phylogenetic pattern of COG0166 is -m--yqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 80-100, 132-165, 78-111, 190-232, 256-282, 323-365, 376-399,
426-453, and 473-505 represent significant (100%) hits to blocks
BL00765A,B,C,D,E,F,G,H, Phosphoglucose isomerase proteins.

ProDom Summary:  Protein Domain Search
Residues 51-505 are 38% similar to glucose-6-phosphate isomerase of
G6PI_CRIGR.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 50 to 527 (E-value = 4.7e-111) place TP0475 in the PGI family which is described as Phosphoglucose isomerase (PF00342)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
53  
87

PDB Hit:
none

Gene Protein Sequence:
MNWRNLDECAAYARLQAIRAPSLKTVLCGPEGIERVRRYCTDAGAGLRYH
YAAKTVNEEILTALAALADEQELVAKYDALRAGAQINTGEKRKVLHHLTR
LGVQGSSLASLPCEVRDMHAFYTKEYERVCAFARQVHEGGLRTSRGAPFT
DVVQIGIGGSDLGPRALYLALEGWAQRHQAVKMRTHFISNVDPDDAALVL
SKLPLETTLFILVSKSGTTLETLSNELFVAHVLRQAGLEPHTQFVAVTSE
TSPLANNPQYLASFYMDDFIGGRYSSSSVCGAVVLTLAFGPQVFGHFLSG
AAEADRAAQEQDIRRNAALLDALIGVYERTILGYEHTAVLPYSQALARFP
AHLQQLDMESNGKSVNRFGIPITYKTGPVIFGEPGTNGQHSFYQHLHQGT
SVVPLQFIAFQHSQLGQDPIIRGSTGQQKLLANVVAQIVAFARGKEHADA
NKTFSGERPSSLLYAKALTPQTLGALLAHFENKIMFQGFAWNLNSFDQEG
VQLGKTLAQHILAGEVEGVLRAYADLFDLAHAPTC

Gene Nucleotide Sequence:  Sequence Viewer
GTGAATTGGAGAAATCTTGACGAGTGTGCCGCATACGCCCGCCTGCAGGC
GATTCGTGCGCCGTCGCTGAAGACAGTACTCTGTGGACCAGAGGGGATAG
AACGTGTGCGGCGCTATTGTACCGACGCGGGGGCTGGGCTGCGCTATCAC
TACGCAGCGAAAACAGTGAATGAAGAAATTCTCACGGCGCTTGCTGCTCT
TGCAGACGAGCAGGAATTAGTCGCAAAGTACGACGCCCTGCGCGCAGGAG
CACAGATAAACACGGGGGAAAAACGTAAGGTGCTGCATCACCTAACGCGC
CTCGGCGTGCAGGGGTCATCGCTTGCCTCGTTGCCGTGCGAAGTGCGCGA
TATGCACGCCTTTTATACAAAAGAATACGAAAGAGTATGTGCGTTCGCAC
GGCAAGTACACGAAGGGGGGCTGCGCACGTCTCGCGGCGCACCGTTTACC
GACGTTGTACAAATTGGAATTGGTGGATCAGATCTCGGTCCACGGGCGTT
GTATCTCGCGCTGGAAGGTTGGGCACAGAGGCACCAGGCGGTTAAGATGC
GCACACATTTTATCTCCAACGTGGACCCAGACGACGCAGCGCTTGTACTC
TCAAAACTACCGCTTGAGACCACGCTTTTTATTTTGGTATCAAAGAGTGG
TACGACGCTTGAAACACTCAGTAATGAGCTTTTCGTCGCACACGTCCTTC
GTCAAGCAGGTCTAGAACCGCACACACAGTTCGTGGCAGTTACCAGCGAG
ACCAGTCCACTTGCAAATAATCCCCAGTACCTTGCTTCCTTCTACATGGA
TGATTTTATCGGTGGACGCTACTCTAGTTCCTCTGTCTGTGGCGCTGTGG
TACTCACGCTTGCGTTTGGACCGCAGGTGTTTGGGCACTTCCTCTCCGGT
GCGGCAGAGGCGGACCGAGCAGCACAGGAACAAGACATACGGCGTAATGC
AGCACTTCTTGACGCGCTCATCGGTGTGTACGAGCGCACTATTCTGGGAT
ACGAGCACACCGCGGTGTTGCCCTATAGCCAGGCGTTGGCTCGCTTTCCT
GCACATTTGCAACAACTAGATATGGAATCTAACGGCAAGAGTGTTAACCG
CTTCGGCATTCCGATAACGTATAAGACCGGCCCGGTGATCTTTGGAGAGC
CTGGGACAAACGGTCAGCACTCGTTCTACCAACATTTGCATCAAGGAACA
TCGGTGGTGCCGCTTCAGTTCATTGCCTTTCAACATAGTCAGCTCGGGCA
GGATCCGATAATCCGTGGATCTACCGGTCAGCAGAAGCTCCTTGCAAATG
TCGTCGCACAAATTGTCGCGTTCGCCAGGGGAAAAGAGCACGCGGATGCA
AATAAAACGTTTTCCGGGGAGCGTCCATCCAGTCTGCTATACGCTAAAGC
GCTTACCCCACAAACGCTCGGCGCACTTCTTGCACACTTTGAAAACAAGA
TTATGTTCCAAGGATTTGCGTGGAACTTGAACAGCTTTGATCAAGAAGGA
GTGCAGCTGGGCAAGACGCTTGCACAACACATATTAGCAGGAGAGGTGGA
AGGCGTGTTGCGCGCCTACGCAGATCTGTTTGATTTAGCACACGCGCCGA
CGTGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy