Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR336 IGR338 IGR334 IGR335 IGR331 IGR339 IGR332 IGR333 IGR337 TP0464 TP0455 TP0466 TP0456 TP0463 TP0461 TP0458 TP0460 TP0459 TP0462 TP0457 TP0464 TP0455 TP0466 TP0456 TP0463 TP0461 TP0458 TP0460 TP0459 TP0462 TP0457 Type: tandem, Name:  - 103 TP0464 TP0455 TP0456 TP0465 TP0466 TP0465 TP0463 TP0458 TP0460 TP0459 TP0462 TP0457 TP0461
* Calculated from Protein Sequence

Gene ID: TP0459

DNA Molecule Name:
1  

Genbank ID:
3322747

Gene Name:


Definition:
conserved hypothetical protein (probable 16S pseudouridine 516 synthase)

Gene Start:
488940

Gene Stop:
489722

Gene Length:
783

Molecular Weight*:
29201

pI*:
10.67

Net Charge*:
18.44

EC:
 

Functional Class:
Conserved hypothetical  

Pathway: pathway table
Nucleotide metabolism; Pyrimidine Metabolism

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to hypothetical proteins.
For example residues 11-214 are 33% similar to conserved hypothetical
protein of Borrelia burgdorferi,(AE001124).

COGS Summary:  COGS Search
BeTs to 11 clades of COG1187
COG name: Predicted pseudouridylate synthase family 1
Functional Class:  J
The phylogenetic pattern of COG1187 is -----QvCEBrHuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 11-34, 123-162, 200-234, and 178-212 represent significant
(100%) hits to blocks BL01149A,B,C, Uncharacterized protein family
UPF0002 proteins. Residues 25-41 and 48-62 represent significant hits
to blocks PR00848C,H, SPERM SURFACE PROTEIN PH20 (HYALURONIDASE)
SIGNATURE, which in humans is a protein involved in adhesin of the sperm
to the egg.

ProDom Summary:  Protein Domain Search
Residues 119-220 are 37% similar to a region of YPUL_BACSU, a
hypothetical protein.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 10 to 56 (E-value = 2.4e-11) place TP0459 in the S4 family which is described as S4 domain (PF01479)
Residues 70 to 216 (E-value = 7.2e-07) place TP0459 in the PseudoU_synth_2 family which is described as RNA pseudouridylate synthase (PF00849)

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
26
non-globular  
34  
72
non-globular  
175  
261

PDB Hit:
none

Gene Protein Sequence:
MCRLQPFFRLRLQVYLARSGCASRRACEALIASGRVTVDGQTVTTQGRTV
CAQNVVCVDGTVVQLERVQRYVLLYKPVGYICSLAPQFPAGYAHTQVRAG
PSKQEYARAIDLVQPAYQERLYHIGRLDVRSEGALLFTNDGSFAQALGHP
RSGIEKEYIVETREPVPAALLSSFVRGVWVEGCRYRCVRARHLAAQCVQL
VLVEGKKREIRVVFEAWGQDVVRLVRVRIGRVRLGPLRPGAFRTMRLQEV
AQLLQCAGCAR

Gene Nucleotide Sequence:  Sequence Viewer
GTGTGCCGCCTGCAGCCGTTTTTTCGCCTCCGGTTACAGGTCTATTTAGC
CAGGAGTGGCTGTGCCTCCCGGCGTGCCTGTGAGGCCTTGATTGCTTCAG
GGCGTGTGACCGTTGATGGTCAGACGGTTACGACACAGGGACGGACCGTT
TGTGCGCAGAATGTGGTGTGTGTGGACGGCACCGTCGTGCAGCTTGAACG
AGTTCAGCGCTACGTGCTCCTGTATAAGCCGGTTGGATATATCTGTTCCC
TCGCGCCGCAGTTTCCTGCCGGGTATGCACACACGCAGGTGCGGGCAGGC
CCGTCCAAACAGGAATACGCGCGTGCAATCGATTTAGTACAGCCTGCGTA
TCAGGAGCGCCTATATCACATCGGCCGGCTGGACGTGCGGTCTGAAGGCG
CGCTGCTGTTCACAAATGATGGTTCGTTTGCGCAGGCTCTTGGCCATCCG
CGTTCGGGAATAGAGAAAGAGTACATTGTAGAAACGCGTGAGCCAGTCCC
TGCAGCGCTGTTGAGCTCTTTTGTGCGTGGGGTGTGGGTGGAAGGGTGCC
GGTATCGGTGCGTGCGCGCGCGGCATCTTGCAGCGCAGTGTGTACAGCTT
GTACTGGTTGAGGGGAAAAAGCGCGAGATCCGTGTGGTATTCGAGGCGTG
GGGACAGGATGTCGTGCGCTTAGTGCGGGTGCGCATTGGCAGGGTGCGTC
TAGGACCGCTGAGGCCCGGAGCATTTCGCACCATGAGGCTGCAGGAAGTT
GCGCAGCTCTTGCAGTGCGCAGGGTGTGCGCGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy