Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR327 IGR331 IGR328 IGR329 IGR330 TP0451 TP0454 TP0455 TP0456 TP0449 TP0448 fusA, - TP0450 ileS, - TP0452 TP0451 TP0454 TP0455 TP0456 TP0449 TP0448 fusA, - TP0450 ileS, - TP0452 Type: tandem, Name:  - 102 TP0451 TP0454 TP0455 TP0456 TP0448 fusA, - TP0450 ileS, - TP0452 TP0453 TP0453 TP0449
* Calculated from Protein Sequence

Gene ID: TP0452

DNA Molecule Name:
1  

Genbank ID:
3322738

Gene Name:
ileS  

Definition:
isoleucyl-tRNA synthetase

Gene Start:
478855

Gene Stop:
482127

Gene Length:
3273

Molecular Weight*:
124241

pI*:
6.38

Net Charge*:
-9.62

EC:
6.1.1.5  

Functional Class:
Translation; Amino acyl tRNA synthetases  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Reaction:
ATP + L-ISOLEUCINE + TRNA(ILE) = AMP + PYROPHOSPHATE + L-ISOLEUCYL-TRNA(ILE).

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to isoleucyl-tRNA synthetase.
For example residues 1-1063 are 46% similar to isoleucyl-tRNA synthetase
(ileS) of Borrelia burgdorferi,(AE001181).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0060
COG name: Isoleucyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0060 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 48-58 and 623-632 represent significant (98%) hits to blocks
BL00178A,B, Aminoacyl-transfer RNA synthetases class-I proteins.

ProDom Summary:  Protein Domain Search
Residues 55-182 are 60% similar to isoleucyl-tRNA synthetase of
SYI_MYCTU.

Paralogs:  Local Blast Search
This protein is paralogously related to TP1035, valyl-tRNA synthetase
and TP0586, leucyl-tRNA synthetase. Residues 4-878 are 23% similar
to TP1035 and residues 11-194 are 30% similar, residues 479-651 are
25% similar to TP0586.

Pfam Summary:  Pfam Search
Residues 17 to 665 (E-value = 6.1e-216) place TP0452 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
205  
272
coil-coil  
886  
917
non-globular  
921  
1049

PDB Hit:
none

Gene Protein Sequence:
MYTPVDPKVDFVAQERRILAFWRERRVFEQSVAQRAQGKSYVFFDGPPFA
TGLPHFGHFVPSTIKDIIPRYQTMRGAYVPRRFGWDCHGLPIEHLIEQEL
NLNSKSDVESYGVSAFNAACRSSVLRYVKEWQRTLTRLGRWVDFDNDYKT
MDVCYMESVWWVVAQLWQRKLLYEGYKILPYCPRCATALSNHELNLGGYQ
DVSDPAITVRFECTSVVPGSPAAREFCAAASWGSASLPAHTCFLAWTTTP
WTLPCNAALALGPQILYVLIEANDEHYILARSRLEFYYPDSSAYRVVWEK
RGEHLAGIRYRPLFSYPVFGQGPDPSVQGDSEEGLFCTRVADFVSTEDGT
GVVHVAPAFGEDDYEVFKDAGISIQCPLDAECRFTAEVADYQGLFVKAAD
KAIIARVQKQGALFRREQISHAYPHCWRCASPLIYRAVHSWFVAVEKIKD
KMLAANASICWQPSHIRDGRFGKWLVCARDWAISRDRYWGNPLPIWRCVH
CGATDCIGSRTQLYERSGMLLEDLHKHVVDMVTIPCACGSVMRRVPEVLD
CWFESGAMPYAQQHYPFEHATDFERYFPAHFISEGLDQTRGWFYTLTILA
VALFERPAFENCIVTGLVLASDGKKMSKALRNYADPNEVMDRYGADALRL
FLVRSAVVRADDLKYSDEGVKDILKTVIIPLWNSYSFYVTYANIDGIDPP
VCAKVDGMGQAVTRLATHLNNPLDRWILSLTEKLVQDIACALDAYDVSKV
ADPIVSYVDQLNNWYIRRSRRRFWKSINDEDKRCAYNTLYCVLKRCVLAI
APVVPFITESIWQNIRAADDVQSVHLADYPVCTPMVRDDALEFKMETVQR
VVSMARAIRAQCNLKVRQPLKAMQVITRNPMERSALLEMEEDVLDELNVK
ELVFHEKEDEIVEYRAKANFRVLGKELGSKTKRAALSIERLSSAEIQEIL
EGTTLYLDVDGDRLELTEEKILVQRIERESLKAINEGTLTVALDTTLTED
LLLEGAIRDLVRGVQNLRKERGFSLVDRICLRVFSSDQDIVCARKAYDLH
RSYIVGETLAAHVQWARVRDGASAVYVKSDAVLWEVSIDKA

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATACGCCTGTGGACCCAAAGGTTGATTTTGTCGCGCAGGAGCGGCG
TATTCTCGCCTTTTGGCGGGAACGCCGGGTGTTTGAGCAGTCTGTGGCGC
AGCGTGCGCAGGGGAAGTCTTATGTTTTCTTTGACGGTCCCCCTTTTGCA
ACTGGACTGCCACATTTTGGTCACTTTGTGCCCAGCACGATTAAGGATAT
TATTCCGCGCTATCAGACAATGCGTGGTGCGTACGTGCCGCGTCGCTTTG
GATGGGATTGTCATGGTCTGCCCATTGAACACCTGATTGAGCAAGAGCTC
AATTTGAATTCAAAAAGTGATGTTGAGTCGTATGGTGTCAGCGCGTTTAA
CGCGGCATGTCGCTCCAGTGTGCTGCGATATGTGAAGGAGTGGCAGCGCA
CACTCACGCGTCTTGGGCGCTGGGTTGACTTCGATAATGACTATAAAACC
ATGGATGTCTGCTACATGGAGTCCGTGTGGTGGGTTGTGGCGCAGCTATG
GCAGCGAAAACTGCTGTATGAAGGTTATAAAATACTCCCGTACTGTCCAC
GGTGTGCGACAGCACTTTCTAATCACGAATTGAATTTAGGTGGATATCAG
GATGTGTCTGATCCTGCCATTACTGTGCGTTTTGAGTGTACATCTGTTGT
TCCTGGTAGTCCTGCTGCACGGGAGTTTTGTGCGGCAGCGTCTTGGGGAA
GTGCATCACTTCCTGCGCATACGTGCTTTCTTGCATGGACCACCACGCCT
TGGACGCTTCCGTGCAACGCAGCGCTTGCGCTGGGACCACAAATTTTGTA
CGTGCTAATAGAGGCGAATGATGAGCACTATATTTTGGCTCGTTCTCGTC
TTGAATTCTATTATCCAGATTCGTCTGCGTACCGCGTAGTGTGGGAAAAA
AGAGGTGAACATCTTGCGGGGATTCGCTATCGGCCGCTTTTTTCTTATCC
TGTGTTTGGGCAGGGACCGGATCCTTCTGTACAAGGAGATTCAGAGGAGG
GATTGTTCTGTACGCGAGTTGCGGATTTTGTTTCTACTGAAGACGGCACT
GGTGTTGTACACGTCGCACCTGCGTTCGGAGAGGATGATTATGAAGTATT
TAAGGATGCGGGTATTTCGATTCAGTGTCCTCTTGATGCAGAGTGTCGCT
TTACCGCAGAGGTTGCAGATTATCAGGGGCTTTTTGTAAAAGCTGCTGAT
AAGGCTATTATTGCACGTGTGCAGAAACAGGGAGCGTTATTTAGACGCGA
ACAGATTTCGCACGCATATCCACACTGTTGGCGTTGTGCGAGTCCACTTA
TTTACCGTGCGGTGCACAGTTGGTTTGTTGCAGTTGAGAAGATAAAGGAT
AAAATGCTTGCGGCGAATGCATCCATTTGCTGGCAGCCATCGCACATACG
TGATGGCCGTTTTGGTAAGTGGCTTGTGTGTGCAAGAGATTGGGCAATTA
GTCGGGATCGTTATTGGGGGAATCCGCTTCCTATTTGGCGGTGTGTGCAC
TGCGGTGCAACAGATTGCATTGGCAGTCGTACGCAGTTATATGAACGTTC
CGGCATGTTGCTTGAAGATTTGCATAAGCACGTTGTAGATATGGTAACAA
TTCCTTGCGCCTGTGGGAGTGTGATGCGACGCGTTCCTGAGGTGCTAGAT
TGTTGGTTTGAATCTGGTGCAATGCCTTATGCGCAGCAGCACTATCCGTT
TGAACATGCAACTGACTTTGAGCGGTATTTCCCTGCTCATTTTATCTCTG
AAGGGTTAGATCAAACGCGAGGGTGGTTTTACACCCTTACCATCTTGGCT
GTGGCACTCTTTGAGCGTCCTGCGTTTGAAAACTGTATCGTTACGGGGTT
GGTACTTGCGTCTGATGGAAAGAAGATGTCCAAGGCCCTGCGCAATTATG
CGGATCCAAATGAAGTCATGGATCGCTACGGTGCTGACGCGCTCCGCCTC
TTTCTTGTTCGTTCTGCGGTTGTCCGTGCGGATGATTTAAAATATTCTGA
CGAAGGGGTGAAAGATATTTTGAAGACTGTGATTATCCCATTGTGGAATA
GTTACAGTTTTTACGTTACGTATGCGAACATCGATGGTATCGATCCTCCT
GTATGTGCAAAAGTTGACGGAATGGGTCAGGCGGTCACGCGTTTAGCGAC
GCATTTGAATAACCCGTTAGATCGTTGGATCTTGTCGCTGACAGAAAAAT
TGGTGCAAGACATTGCCTGTGCACTTGATGCTTACGATGTATCGAAAGTT
GCGGATCCTATCGTTTCGTATGTAGATCAGCTGAACAACTGGTACATCCG
CCGATCTCGAAGGAGATTTTGGAAAAGCATCAACGATGAAGATAAACGAT
GTGCGTACAACACGTTGTATTGCGTGCTGAAAAGATGTGTGCTCGCTATT
GCTCCCGTGGTGCCATTCATCACCGAGAGTATATGGCAGAATATCCGCGC
CGCGGATGATGTGCAGTCTGTGCATCTTGCAGACTATCCTGTTTGTACAC
CAATGGTGCGAGACGATGCACTCGAGTTTAAAATGGAAACAGTGCAGCGA
GTTGTTTCTATGGCGCGTGCGATCCGAGCGCAGTGTAACCTCAAAGTACG
CCAGCCACTTAAAGCTATGCAGGTTATTACGCGTAACCCGATGGAGCGCT
CAGCACTTCTTGAAATGGAAGAAGATGTGCTTGATGAGCTTAATGTAAAA
GAGCTCGTGTTTCATGAGAAAGAAGACGAGATAGTAGAGTACCGTGCAAA
AGCGAATTTTAGAGTGCTCGGAAAAGAGCTTGGATCGAAGACAAAGCGTG
CAGCGCTCAGCATTGAGCGGTTGTCTTCTGCAGAAATTCAGGAGATACTC
GAGGGGACGACGCTGTATCTGGATGTAGATGGAGATCGTTTGGAGTTGAC
TGAGGAAAAGATCCTGGTGCAAAGAATTGAGCGCGAGTCTTTGAAAGCGA
TAAATGAAGGGACACTTACGGTCGCGCTTGACACCACCTTAACGGAAGAT
CTGCTCTTGGAAGGAGCAATTAGGGACTTGGTGCGCGGAGTTCAAAATTT
ACGCAAGGAGCGTGGGTTTTCCTTAGTGGATCGTATTTGTCTGCGCGTTT
TTTCTTCAGATCAGGATATAGTGTGTGCCCGCAAGGCGTATGATCTGCAT
AGGTCATATATCGTTGGCGAGACGTTGGCAGCGCATGTGCAATGGGCACG
CGTGCGCGACGGTGCTTCTGCAGTGTACGTTAAATCGGACGCAGTACTAT
GGGAGGTGAGCATTGATAAGGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy