Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR327 IGR323 IGR325 IGR326 IGR324 IGR328 IGR329 TP0451 TP0449 thiJ, - TP0445 TP0443 TP0444 TP0448 TP0447 gcpE, - TP0446 fusA, - TP0450 ileS, - TP0452 TP0451 TP0449 thiJ, - TP0445 TP0443 TP0444 TP0448 TP0447 gcpE, - TP0446 fusA, - TP0450 ileS, - TP0452 Type: tandem, Name:  - 102 Type: tandem, Name:  - 99 Type: tandem, Name:  - 100 Type: tandem, Name:  - 101 TP0451 TP0449 thiJ, - TP0445 TP0444 TP0448 TP0447 gcpE, - TP0446 fusA, - TP0450 ileS, - TP0452 TP0443
* Calculated from Protein Sequence

Gene ID: TP0448

DNA Molecule Name:
1  

Genbank ID:
3322732

Gene Name:


Definition:
possible uracil phosphoribosyltransferase

Gene Start:
474541

Gene Stop:
475620

Gene Length:
1080

Molecular Weight*:
41005

pI*:
5.76

Net Charge*:
-5.52

EC:
2.4.2.9  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Nucleotide metabolism; Pyrimidine Metabolism

Secondary Evidence:
Fabret C, Ehrlich SD, Noirot P.
A new mutation delivery system for genome-scale approaches in Bacillus subtilis.
Mol Microbiol. 2002 Oct;46(1):25-36.
PMID: 12366828

Cheng Y, Dylla SM, Turnbough CL.
A long T. A tract in the upp initially transcribed region is required for regulation of upp expression by UTP-dependent reiterative transcription in Escherichia coli.
J Bacteriol. 2001 Jan;183(1):221-8.
PMID: 11114920

Tiraby M, Cazaux C, Baron M, Drocourt D, Reynes JP, Tiraby G.
Concomitant expression of E. coli cytosine deaminase and uracil phosphoribosyltransferase improves the cytotoxicity of 5-fluorocytosine.
FEMS Microbiol Lett. 1998 Oct;167(1):41-9.
PMID: 9785450

Martinussen J, Hammer K.
Cloning and characterization of upp, a gene encoding uracil phosphoribosyltransferase from Lactococcus lactis.
J Bacteriol. 1994 Nov;176(21):6457-63.
PMID: 7961396

Comment:
Reaction:
UMP + PYROPHOSPHATE = URACIL + 5-PHOSPHO-ALPHA-D-RIBOSE 1-DIPHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed that the C-terminal region was similar to many uracil
phosphoribosyltransferases. For example residues 221-320 are 40%
similar to uracil phosphoribosyltransferase of Methanobacterium
thermoautotrophicum,(AE000881).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0035
COG name: Uracil phosphoribosyltransferase
Functional Class:? F
The phylogenetic pattern of COG0035 is --t-Yqvcebrh--gp-l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 250-317 are 36% similar to uracil phosphoribosyltransferase
of UPP_TOXGO.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MEGQTARRVITEAKFLDDCLTERDSYYLSKLDELYSSAMSSFAQFEDQQN
GARSARAEENIIATYDSIGNLMQEICKELPALKVYSFETQRENHAEVSRV
VSKLRNIHTGYSEFIYYTQRAFEMLFRLAYGGSHEEHKTYLITKTPVAFP
VQNYAVHKIANVDYKIENTVMCVMLRGALLPSMIVSKEIEEYSSHGYVTP
FALFKIKRDDLRDERDMQYVFDLDKSYFSARELDGKDLVFADPMNATGGS
LVTIVRYLQDLGVKPKSISCFHMISALKGAIRVVRSLENCTVYTLWMDPV
LNARAYIMPGLGDAGDRVNGVDVEDYPRNIIQLLADYGSNISGLYRSQLR
KIEETVLGSR

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGGGCAGACGGCGCGCAGAGTGATCACGGAGGCAAAGTTTCTTGA
TGACTGTTTGACAGAACGTGACAGCTATTATCTGAGTAAATTGGACGAGT
TGTACTCATCTGCGATGAGTTCTTTTGCGCAGTTTGAAGATCAGCAGAAT
GGAGCGCGTAGCGCACGCGCTGAAGAAAATATCATCGCTACATATGACAG
TATCGGGAATCTGATGCAGGAGATCTGTAAAGAATTACCCGCGCTGAAGG
TATATTCGTTTGAAACGCAACGAGAGAACCATGCAGAAGTTTCTCGAGTT
GTTTCAAAGCTGCGTAATATTCATACCGGATATAGTGAATTCATCTACTA
CACACAGCGTGCGTTTGAAATGCTGTTTAGGCTTGCCTACGGCGGCTCTC
ATGAAGAGCATAAAACATATCTTATTACAAAAACACCGGTTGCTTTTCCT
GTACAAAACTATGCAGTACATAAAATTGCAAACGTGGATTATAAAATTGA
GAACACGGTGATGTGTGTCATGTTACGAGGAGCGCTGTTACCTTCGATGA
TTGTTTCTAAGGAGATAGAAGAATATTCTTCGCATGGGTACGTAACGCCG
TTTGCGCTTTTTAAAATCAAGCGAGATGATCTCCGTGATGAGCGCGATAT
GCAGTATGTGTTTGATCTGGATAAATCATACTTTTCTGCACGAGAGTTGG
ATGGTAAGGATCTGGTTTTCGCCGATCCCATGAACGCCACCGGTGGTAGT
TTGGTTACCATAGTGCGTTATTTGCAAGATCTCGGTGTGAAACCAAAATC
TATCAGCTGTTTTCACATGATTTCTGCACTGAAAGGTGCGATTCGTGTAG
TGCGTTCCCTAGAGAATTGCACGGTGTATACGCTGTGGATGGATCCCGTA
CTCAACGCGCGTGCGTATATTATGCCTGGTCTTGGCGATGCTGGTGATCG
AGTTAACGGGGTTGATGTTGAAGACTATCCGCGGAATATTATCCAGCTTT
TGGCAGACTATGGTTCAAATATTTCTGGCCTGTACCGGTCCCAGCTCCGC
AAGATAGAGGAAACGGTATTAGGTTCTCGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy