Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR312 IGR313 IGR315 IGR314 IGR316 IGR317 IGR318 IGR319 TP0435 TP0436 atpK, - TP0430 TP0432 atpD, - TP0428 TP0433 TP0431 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 TP0435 TP0436 atpK, - TP0430 TP0432 atpD, - TP0428 TP0433 TP0431 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 Type: tandem, Name:  - 251 Type: tandem, Name:  - 312 Type: tandem, Name:  - 313 Type: tandem, Name:  - 313 TP0435 TP0436 TP0437 TP0437 atpK, - TP0430 TP0432 atpD, - TP0428 TP0433 TP0431 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 TP0434 TP0434
* Calculated from Protein Sequence

Gene ID: TP0430

DNA Molecule Name:
1  

Genbank ID:
3322713

Gene Name:
atpK  

Definition:
V-type ATPase subunit K

Gene Start:
458607

Gene Stop:
459026

Gene Length:
420

Molecular Weight*:
14172

pI*:
8.17

Net Charge*:
1.79

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Murata T, Takase K, Yamato I, Igarashi K, Kakinuma Y.
Properties of the V0V1 Na+-ATPase from Enterococcus hirae and its V0 moiety.
J Biochem (Tokyo). 1999 Feb;125(2):414-21.
PMID: 9990142

Comment:
V-type ATPases (more correctly the V-F0F1 type ATPases) are one of two
subgroups of the F0F1-ATPases (the other subgroup being the F-F0F1 type).
The V subgroup are found mainly in archaebacteria and the endomembrane
or vacuolar system of eukaryotic cells. However, there are examples of
V types in eubacteria such as the ntp cluster in Enterococcus hirae.
This cluster is believed to encode a Na-translocating V-type ATPase that
is expressed when the normal F-type ATPase is inoperative.

See TP0424 atpE
See TP0426 atpA
See TP0427 atpB
See TP0428 atpD
See TP0429 atpI
See TP0527 atpD
See TP0528 atpB
See TP0529 atpA
See TP0530 atpE
See TP0531 atpF
See TP0532 atpK
See TP0533 atpI

Blast Summary:  PSI-Blast Search
Gapped BLAST returned only one significant hit in the database. Residues
1-138 are 39% similar to a putative V-type ATPase, subunit K of
Borrelia burgdorferi,(AE001122).

COGS Summary:  COGS Search
BeTs to 5 clades of COG0636
COG name: FoF1-type ATP synthase c subunit/Vacuolar ATPase/archaeal ATP synthase K subunit
Functional Class:? C
The phylogenetic pattern of COG0636 is AmtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram positive signal  
1  
26
transmembrane  
46  
65
transmembrane  
121  
139

PDB Hit:
none

Gene Protein Sequence:
MNFGMFGAAAVLGISAVGSALGLALAGQGTIGSWKRCYLNNKPAPFILLA
FAGAPLTQTIYGFLLMKAMFSSEKDPWYLLGAGVACGLGIAASALSQGRA
AAAGADALAETGKGFSQYLTIVGLCETVALLVMVFGIINC

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATTTTGGTATGTTTGGCGCCGCGGCGGTGCTGGGGATCTCTGCGGT
GGGTTCTGCGCTCGGCTTGGCTTTGGCAGGGCAGGGAACGATTGGTTCGT
GGAAGCGCTGTTATCTGAATAATAAGCCCGCTCCCTTTATCTTGCTTGCC
TTTGCGGGGGCTCCCCTTACGCAGACTATTTATGGTTTTTTGCTAATGAA
GGCGATGTTTTCTTCTGAAAAGGACCCGTGGTACCTACTCGGCGCGGGGG
TTGCGTGCGGTTTGGGAATTGCCGCTTCGGCGCTTTCTCAAGGGCGGGCT
GCCGCAGCCGGCGCCGATGCGCTTGCAGAAACAGGTAAAGGATTTAGCCA
GTATTTGACTATCGTTGGTTTGTGTGAGACGGTGGCGCTTCTGGTGATGG
TTTTTGGTATTATCAACTGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy