Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR312 IGR313 IGR315 IGR314 IGR316 IGR317 IGR318 IGR319 IGR311 TP0435 TP0436 TP0425 atpK, - TP0430 TP0432 atpD, - TP0428 TP0433 TP0431 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 TP0435 TP0436 TP0425 atpK, - TP0430 TP0432 atpD, - TP0428 TP0433 TP0431 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 Type: tandem, Name:  - 251 Type: tandem, Name:  - 312 Type: tandem, Name:  - 313 Type: tandem, Name:  - 313 TP0436 TP0435 TP0425 atpK, - TP0430 TP0432 atpD, - TP0428 TP0433 TP0431 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 TP0434 TP0434
* Calculated from Protein Sequence

Gene ID: TP0429

DNA Molecule Name:
1  

Genbank ID:
3322712

Gene Name:
atpI  

Definition:
V-type ATPase subunit I

Gene Start:
456702

Gene Stop:
458567

Gene Length:
1866

Molecular Weight*:
69069

pI*:
7.77

Net Charge*:
5.89

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Yokoyama K, Ohkuma S, Taguchi H, Yasunaga T, Wakabayashi T, Yoshida M.
V-Type H+-ATPase/synthase from a thermophilic eubacterium, Thermus thermophilus. Subunit structure and operon.
J Biol Chem. 2000 May;275(18):13955-61.
PMID: 10788522

Borghese R, Turina P, Lambertini L, Melandri BA.
The atpIBEXF operon coding for the F0 sector of the ATP synthase from the purple nonsulfur photosynthetic bacterium Rhodobacter capsulatus.
Arch Microbiol. 1998 Oct;170(5):385-8.
PMID: 9818357

Kasimoglu E, Park SJ, Malek J, Tseng CP, Gunsalus RP.
Transcriptional regulation of the proton-translocating ATPase (atpIBEFHAGDC) operon of Escherichia coli: control by cell growth rate.
J Bacteriol. 1996 Oct;178(19):5563-7.
PMID: 8824597

Schramm HC, Schneppe B, Birkenhäger R, McCarthy JE.
The promoter-proximal, unstable IB region of the atp mRNA of Escherichia coli: an independently degraded region that can act as a destabilizing element.
Biochim Biophys Acta. 1996 Jun;1307(2):162-70.
PMID: 8679701

Comment:
V-type ATPases (more correctly the V-F0F1 type ATPases) are one of two
subgroups of the F0F1-ATPases (the other subgroup being the F-F0F1 type).
The V subgroup are found mainly in archaebacteria and the endomembrane
or vacuolar system of eukaryotic cells. However, there are examples of
V types in eubacteria such as the ntp cluster in Enterococcus hirae.
This cluster is believed to encode a Na-translocating V-type ATPase that
is expressed when the normal F-type ATPase is inoperative.

See TP0424 atpE
See TP0426 atpA
See TP0427 atpB
See TP0428 atpD
See TP0430 atpK
See TP0527 atpD
See TP0528 atpB
See TP0529 atpA
See TP0530 atpE
See TP0531 atpF
See TP0532 atpK
See TP0533 atpI

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed four significant hits to V-type ATPase, subunit I
and one significant hit to ntpM protein. However only one hit was
across the whole protein. Residues 1-621 are 27% similar to a putative
V-type ATPase, subunit I, of Borrelia burgdorferi, (AE001122).

COGS Summary:  COGS Search
BeTs to 8 clades of COG1269
COG name: Archaeal/vacuolar-type H+-ATPase subunit I
Functional Class:? C
The phylogenetic pattern of COG1269 is amtkY-----------oLin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 565-577 represent significant (98%) hits to block PR00167G,
CALCIUM CHANNEL SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 493-620 are 31% similar to V-type ATPase, subunit I of
ATPI_METJA.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 21 to 622 (E-value = 3.6e-13) place TP0429 in the V_ATPase_I family which is described as V-type ATPase 116kDa subunit family (PF01496)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
198
coil-coil  
199  
229
transmembrane  
329  
362
transmembrane  
376  
407
non-globular  
435  
486
transmembrane  
490  
508
transmembrane  
525  
551
transmembrane  
563  
593

PDB Hit:
none

Gene Protein Sequence:
MIVPMKKVTLLVLGSEQERSLQALRSFGAVHVQLRECASEQLAELHALDA
RCVQAIALVTDAQTKNVTRGEECRVAGQVVEAAEAVEQIVRTHSDRVELA
QRIAQCIAHLERCEPWGDFDPADVRALAQRGIHLIPVELSERSYRCLPDE
LQTLCLARRGGLVRCVLVADKPGLPPSLPADARALELPDVSPADLFVRLR
QLREECATLTQRLLAYSEYQGAIRALRQKIAADIEFERVHLSMVSVDVSQ
WRETGETLRIAHVSGYLPVSRVRAFSECARKEAWAYCCVDPMPEDPVPTQ
LRNNRWVNLISPLMNFLGTVPGYWEVDISGFFLLFFGVFFSIIFADAGYG
AVLTLVSLGGIVLSKRKHAVVSPAWCLGLYLGTLTMVWGALVCNWFGVPV
QYVPASLARIAVWEISGFADAAQRNKNQMHVCFFLGLLHLCLGHLIVVRR
TFRSLRVLAEFGSLLMLGGMYVVVLNLIVDKERYPLTGMIVGSIIAGFVL
NFIFVNYRVSVRQSVADSMKNVINALLGIVNVFADVMSYIRLWAVGLAGG
AISATVNEMTHPLFANFLAFLGIVLLLFGHGLNYVMSILSVIVHGVRLNT
LEFSNHVGLMWTGIRYTPFRER

Gene Nucleotide Sequence:  Sequence Viewer
GTGATAGTTCCTATGAAAAAGGTAACGCTTCTGGTGCTCGGTTCTGAGCA
AGAGCGTTCGCTGCAGGCGTTGCGTTCCTTTGGTGCTGTGCATGTGCAGT
TGCGGGAGTGTGCAAGTGAGCAACTTGCAGAGTTGCACGCGTTGGACGCT
CGGTGCGTGCAGGCCATTGCGCTCGTCACTGACGCTCAGACAAAGAATGT
TACCCGAGGAGAGGAGTGTCGCGTTGCAGGTCAGGTGGTAGAAGCAGCAG
AGGCCGTGGAACAGATCGTACGTACTCATTCAGACCGCGTGGAACTTGCT
CAGCGCATTGCGCAGTGCATTGCGCATCTGGAACGCTGTGAGCCGTGGGG
GGATTTCGATCCGGCAGATGTGAGGGCACTCGCACAGCGGGGGATACATC
TTATCCCCGTGGAGCTTTCTGAGCGTTCATACCGCTGCTTGCCCGATGAG
TTGCAGACGCTTTGTCTTGCTCGTCGCGGGGGCTTGGTGCGCTGTGTGCT
TGTGGCAGATAAACCGGGGCTGCCGCCATCTCTTCCTGCCGATGCGCGCG
CGCTAGAATTGCCAGACGTTTCTCCCGCTGATCTGTTTGTACGGCTCAGG
CAGTTGCGTGAGGAGTGCGCTACGCTAACACAACGGCTTCTTGCTTATTC
GGAATACCAAGGGGCGATTCGCGCCTTGCGGCAGAAGATTGCCGCAGATA
TCGAGTTTGAGCGCGTGCATCTCAGTATGGTTTCGGTAGACGTCAGTCAG
TGGCGTGAAACAGGAGAGACGTTGCGCATTGCGCACGTCAGTGGGTACCT
GCCTGTTTCCCGGGTGCGTGCCTTTTCTGAGTGTGCGCGGAAGGAAGCGT
GGGCGTATTGCTGTGTAGACCCTATGCCTGAGGATCCGGTACCTACACAG
CTGAGAAATAACCGTTGGGTAAATTTGATTTCCCCGTTGATGAATTTCCT
CGGCACTGTGCCCGGCTATTGGGAGGTAGACATTTCTGGCTTCTTTTTGC
TCTTTTTTGGCGTGTTCTTCTCAATCATCTTTGCGGACGCAGGCTACGGC
GCAGTCCTCACGCTTGTGTCCTTGGGAGGGATTGTTCTCAGCAAGAGAAA
ACATGCAGTGGTGAGTCCAGCATGGTGCTTGGGACTATACTTAGGAACGC
TCACGATGGTGTGGGGTGCGCTCGTGTGTAACTGGTTTGGTGTGCCTGTC
CAGTATGTGCCGGCGTCGCTCGCGCGTATTGCAGTTTGGGAGATTTCAGG
CTTTGCGGATGCCGCCCAGCGGAATAAGAATCAGATGCACGTGTGTTTCT
TTCTCGGTTTATTGCACCTGTGTCTCGGTCATTTGATCGTCGTGCGGCGC
ACCTTCCGTTCCCTGAGGGTGCTTGCAGAGTTTGGTTCTCTTCTCATGTT
GGGTGGTATGTACGTGGTAGTGCTCAACTTGATTGTTGACAAAGAGCGCT
ATCCGCTTACCGGCATGATTGTCGGGTCTATAATAGCGGGTTTTGTGCTG
AATTTTATCTTTGTGAATTATCGGGTGAGTGTGCGGCAGAGTGTTGCAGA
CAGTATGAAAAACGTAATTAATGCGTTGCTGGGCATTGTAAATGTATTTG
CAGATGTCATGAGTTATATTCGGCTTTGGGCGGTGGGATTGGCCGGAGGG
GCAATCAGTGCGACAGTTAATGAAATGACACACCCTCTGTTTGCCAATTT
CCTGGCGTTCCTTGGGATAGTGCTACTGCTGTTTGGACACGGGCTGAATT
ACGTAATGAGCATACTGTCGGTGATTGTGCACGGTGTGCGCTTGAATACC
TTGGAGTTTTCTAATCATGTGGGTCTGATGTGGACAGGCATACGATATAC
TCCCTTTAGGGAGCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy