Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR312 IGR313 IGR315 IGR314 IGR316 IGR317 IGR311 IGR310 atpK, - TP0430 TP0432 atpD, - TP0428 atpE, - TP0424 TP0433 TP0423 TP0431 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 atpK, - TP0430 TP0432 atpD, - TP0428 atpE, - TP0424 TP0433 TP0423 TP0431 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 Type: tandem, Name:  - 313 Type: tandem, Name:  - 251 Type: tandem, Name:  - 311 Type: tandem, Name:  - 312 Type: tandem, Name:  - 313 atpK, - TP0430 TP0432 atpD, - TP0428 atpE, - TP0424 TP0433 TP0423 TP0431 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 TP0425 TP0434 TP0425 TP0434
* Calculated from Protein Sequence

Gene ID: TP0428

DNA Molecule Name:
1  

Genbank ID:
3322711

Gene Name:
atpD  

Definition:
V-type ATPase subunit D

Gene Start:
456085

Gene Stop:
456702

Gene Length:
618

Molecular Weight*:
23788

pI*:
10.44

Net Charge*:
10.34

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Gaunt MW, Turner SL, Rigottier-Gois L, Lloyd-Macgilp SA, Young JP.
Phylogenies of atpD and recA support the small subunit rRNA-based classification of rhizobia.
Int J Syst Evol Microbiol. 2001 Nov;51(Pt 6):2037-48.
PMID: 11760945

Christensen H, Olsen JE.
Phylogenetic relationships of Salmonella based on DNA sequence comparison of atpD encoding the beta subunit of ATP synthase.
FEMS Microbiol Lett. 1998 Apr;161(1):89-96.
PMID: 9561735

Das A, Ljungdahl LG.
Composition and primary structure of the F1F0 ATP synthase from the obligately anaerobic bacterium Clostridium thermoaceticum.
J Bacteriol. 1997 Jun;179(11):3746-55.
PMID: 9171425

Comment:
V-type ATPases (more correctly the V-F0F1 type ATPases) are one of two
subgroups of the F0F1-ATPases (the other subgroup being the F-F0F1 type).
The V subgroup are found mainly in archaebacteria and the endomembrane
or vacuolar system of eukaryotic cells. However, there are examples of
V types in eubacteria such as the ntp cluster in Enterococcus hirae.
This cluster is believed to encode a Na-translocating V-type ATPase that
is expressed when the normal F-type ATPase is inoperative.

See TP0424 atpE
See TP0426 atpA
See TP0427 atpB
See TP0429 atpI
See TP0430 atpK
See TP0527 atpD
See TP0528 atpB
See TP0529 atpA
See TP0530 atpE
See TP0531 atpF
See TP0532 atpK
See TP0533 atpI

Blast Summary:  PSI-Blast Search
Gapped BLAST returned few significant hits to V-type ATPase, subunit D.
For example residues 3-199 are 45% similar to V-type ATPase, subunit D
(atpD) of Borrelia burgdorferi,(AE001122).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1394
COG name: Archaeal/vacuolar type H+-ATPase subunit D
Functional Class:? C
The phylogenetic pattern of COG1394 is amtky-----------oLin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 121-191 are 30% similar to V-type ATPase, subunit D of
ATPD_METJA, however the score is low.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 1 to 196 (E-value = 3.5e-82) place TP0428 in the ATP-synt_D family which is described as ATP synthase subunit D (PF01813)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
31  
58

PDB Hit:
none

Gene Protein Sequence:
MAVRLTKNELKRQKETLKTFRRFLPTLQLKKQQLYAEIRAVEARASEVRS
RADALRQDVQQWVAVFSESGVFDARLLRVQEVKKTYASIAGVRIPCFLEV
HFACPPYDLYRVPLWVDTAVRKMQEVLSLDLEAHVLDEQALLLGAELRTT
TQRVNLFEKVKIPETRACIRKITVYLGDQQVAAVVRGKMSKKNLVDVSRM
EQEDTR

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCGGTGCGCTTAACCAAAAATGAACTGAAACGTCAAAAAGAGACGCT
CAAGACGTTTCGCCGTTTTCTCCCTACGCTTCAGCTTAAAAAGCAGCAGT
TGTATGCTGAGATCCGTGCCGTTGAGGCGCGCGCTTCTGAAGTACGTTCC
CGTGCAGATGCCCTGCGTCAGGATGTTCAGCAGTGGGTTGCAGTTTTTTC
TGAAAGCGGTGTGTTCGACGCGCGTTTGCTCCGCGTGCAAGAGGTAAAGA
AAACGTATGCTAGCATTGCAGGTGTGCGTATTCCCTGCTTTTTAGAAGTG
CACTTTGCTTGTCCTCCCTATGACTTATATCGTGTTCCTCTGTGGGTGGA
TACTGCAGTGCGCAAAATGCAGGAAGTGCTAAGCTTAGACTTGGAGGCGC
ATGTTCTCGACGAACAGGCGCTTCTCCTGGGTGCAGAGTTGCGGACTACA
ACGCAGCGTGTTAACCTCTTTGAAAAAGTTAAGATTCCTGAGACGCGGGC
ATGCATACGGAAAATAACGGTGTACCTCGGTGATCAGCAGGTTGCTGCAG
TAGTGCGGGGGAAGATGTCTAAGAAGAATCTGGTAGACGTGAGTCGGATG
GAACAAGAGGATACACGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy