Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR312 IGR313 IGR309 IGR315 IGR314 IGR316 IGR311 IGR310 atpK, - TP0430 TP0432 atpD, - TP0428 atpE, - TP0424 TP0423 TP0431 TP0422 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 atpK, - TP0430 TP0432 atpD, - TP0428 atpE, - TP0424 TP0423 TP0431 TP0422 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 Type: tandem, Name:  - 251 Type: tandem, Name:  - 311 atpK, - TP0430 TP0432 atpD, - TP0428 atpE, - TP0424 TP0431 TP0422 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 TP0425 TP0425 TP0423
* Calculated from Protein Sequence

Gene ID: TP0427

DNA Molecule Name:
1  

Genbank ID:
3322710

Gene Name:
atpB  

Definition:
V-type ATPase subunit B

Gene Start:
454781

Gene Stop:
456070

Gene Length:
1290

Molecular Weight*:
47218

pI*:
5.09

Net Charge*:
-8.90

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Borghese R, Turina P, Lambertini L, Melandri BA.
The atpIBEXF operon coding for the F0 sector of the ATP synthase from the purple nonsulfur photosynthetic bacterium Rhodobacter capsulatus.
Arch Microbiol. 1998 Oct;170(5):385-8.
PMID: 9818357

Das A, Ljungdahl LG.
Composition and primary structure of the F1F0 ATP synthase from the obligately anaerobic bacterium Clostridium thermoaceticum.
J Bacteriol. 1997 Jun;179(11):3746-55.
PMID: 9171425



Comment:
V-type ATPases (more correctly the V-F0F1 type ATPases) are one of two
subgroups of the F0F1-ATPases (the other subgroup being the F-F0F1 type).
The V subgroup are found mainly in archaebacteria and the endomembrane
or vacuolar system of eukaryotic cells. However, there are examples of
V types in eubacteria such as the ntp cluster in Enterococcus hirae.
This cluster is believed to encode a Na-translocating V-type ATPase that
is expressed when the normal F-type ATPase is inoperative.

See TP0424 atpE
See TP0426 atpA
See TP0428 atpD
See TP0429 atpI
See TP0430 atpK
See TP0527 atpD
See TP0528 atpB
See TP0529 atpA
See TP0531 atpF
See TP0532 atpK
See TP0533 atpI

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to V-type ATPase,
subunit B. For example residues 1-429 are 72% similar to V-type ATPase,
subunit B (atpB) of Borrelia burgdorferi,(AE001122).

COGS Summary:  COGS Search
BeTs to 8 clades of COG1156
COG name: Vacuolar ATPase/archaeal ATP synthase B subunit (NtpB)
Functional Class:? C
The phylogenetic pattern of COG1156 is amtky-----------oLin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 70-95, 235-279, and 302-339 represent significant (99%) hits to
blocks BL00152A,C,D ATP synthase alpha and beta subunits proteins.
Residues 345-354 represent a significant (97%) hit to block PR00357D
TYPE III ANTIFREEZE PROTEIN SIGNATURE. Residues 36-47, 274-302, and
55-67 represent significant (96%) hits to blocks BL00502A,B,C
Polygalacturonase proteins.

ProDom Summary:  Protein Domain Search
Residues 199-365 are 45% similar to V-type ATPase, subunit B of
VATB_CYACA. Residues 128-166 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0528, V-type ATPase,
subunit B (atpB), TP0402, flagellum-specific ATP synthase (fliI),
TP0529, V-type ATPase, subunit A (atpA), and TP0426, V-type ATPase,
subunit A. Residues 5-430 are 37% similar to TP0528, residues 8-397
are 26% similar to TP0402, residues 115-307 are 23% similar to
TP0529 and residues 115-307 are 24% similar to TP0426.

Pfam Summary:  Pfam Search
Residues 8 to 71 (E-value = 9.7e-11) place TP0427 in the ATP-synt_ab_N family which is described as ATP synthase alpha/beta family, beta-barrel domain (PF02874)
Residues 166 to 335 (E-value = 3.5e-44) place TP0427 in the ATP-synt_ab family which is described as ATP synthase alpha/beta family, nucleotide-binding domain (PF00006)

PDB Hit:
none

Gene Protein Sequence:
MYKVYEKIESINGSVITVRAKGVHYGELARVKTAFGDSLAEVNKLEGDVV
SLQVFAGGRGISTGSEVRFLGRGMLVSFSDYLLGRIFNGSGVPRDGGPAL
KEGRVEIGGPSVNPAKRVIARRMIRTGIPMIDVFNTLVVSQKLPIFSSSG
EPYNELLARIAMQAEVDVIVLGGMGLKHDDYLYFKSALEEAGALSRAVLF
VHTASDPTVECLMVPDMCLAVAEQFALKGRDVLVLLTDMTNFADAMKEIA
IIQEQVPSNRGYPGDLYSQLASRYEKAVDFDDAGSVTILAVTTMPGDDVT
HPVPDNTGYITEGQFYLKNGRIEPFGSLSRLKQNVNGRTRADHRALMDNM
IKLYAAYRDALEKRSMGFAMSEWDEKLLTYGGLFEAQLMDLSVNIPLEEA
FDTGWKILGRCFTPEETGIRSDLINTYWPA

Gene Nucleotide Sequence:  Sequence Viewer
ATGTACAAGGTGTACGAGAAGATTGAGTCGATCAACGGTTCTGTCATCAC
GGTGCGGGCAAAGGGGGTGCATTACGGGGAATTGGCCCGGGTAAAAACGG
CGTTTGGCGATTCGCTTGCTGAGGTGAATAAGCTTGAAGGGGATGTAGTT
TCCCTGCAGGTGTTTGCGGGAGGCCGGGGTATTTCCACCGGGAGCGAGGT
GCGCTTTCTGGGGAGGGGTATGCTCGTGAGTTTCTCAGATTATTTATTGG
GGAGAATTTTTAATGGCTCTGGCGTTCCCCGAGACGGTGGTCCGGCCTTA
AAGGAAGGGAGGGTGGAAATTGGCGGTCCTTCGGTTAATCCGGCAAAGAG
GGTTATCGCGCGGCGTATGATTCGCACGGGTATTCCCATGATTGATGTGT
TTAATACGCTGGTTGTTTCTCAGAAGTTGCCTATTTTTTCTAGCTCAGGG
GAACCGTACAACGAACTGCTGGCCCGTATTGCAATGCAAGCGGAGGTTGA
TGTCATCGTCCTCGGGGGTATGGGGCTGAAGCATGACGATTACCTGTATT
TTAAAAGTGCATTGGAAGAGGCAGGAGCGTTGAGTAGGGCAGTCCTGTTC
GTGCACACTGCCTCAGATCCTACCGTAGAATGTTTGATGGTCCCTGATAT
GTGTCTTGCAGTTGCCGAGCAGTTTGCCTTGAAGGGTAGGGATGTGTTGG
TGCTCTTAACCGACATGACTAATTTTGCTGATGCTATGAAGGAAATTGCG
ATTATTCAGGAACAAGTTCCCTCGAATCGTGGGTATCCGGGTGACTTGTA
CAGCCAGCTTGCGTCGCGCTATGAAAAGGCGGTCGATTTTGATGATGCAG
GGTCAGTGACTATCCTTGCCGTTACCACCATGCCAGGGGATGATGTTACG
CATCCGGTTCCTGATAACACGGGGTACATTACTGAGGGTCAGTTTTATCT
GAAGAACGGGCGCATTGAACCTTTCGGGAGTCTATCCCGTCTTAAGCAGA
ACGTAAACGGGCGTACGCGTGCAGATCATCGCGCGCTTATGGATAATATG
ATTAAGTTGTATGCCGCCTATCGTGATGCGCTTGAGAAAAGATCTATGGG
TTTTGCCATGAGCGAGTGGGATGAGAAACTGCTCACATACGGTGGGCTGT
TTGAAGCGCAGCTCATGGATCTTTCGGTGAATATTCCGCTTGAAGAGGCG
TTCGATACGGGGTGGAAAATTCTGGGCCGGTGTTTCACCCCAGAGGAGAC
GGGGATTCGCTCTGATTTGATTAACACGTATTGGCCTGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy