Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR312 IGR313 IGR309 IGR314 IGR311 IGR310 atpK, - TP0430 atpD, - TP0428 atpE, - TP0424 TP0423 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 TP0421 atpK, - TP0430 atpD, - TP0428 atpE, - TP0424 TP0423 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 TP0421 Type: tandem, Name:  - 251 Type: tandem, Name:  - 311 atpK, - TP0430 atpD, - TP0428 atpE, - TP0424 TP0423 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 TP0421 TP0425 TP0422 TP0422 TP0425
* Calculated from Protein Sequence

Gene ID: TP0426

DNA Molecule Name:
1  

Genbank ID:
3322709

Gene Name:
atpA  

Definition:
V-type ATPase subunit A

Gene Start:
453008

Gene Stop:
454774

Gene Length:
1767

Molecular Weight*:
65011

pI*:
6.11

Net Charge*:
-7.18

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
V-type ATPases (more correctly the V-F0F1 type ATPases) are one of two
subgroups of the F0F1-ATPases (the other subgroup being the F-F0F1 type).
The V subgroup are found mainly in archaebacteria and the endomembrane
or vacuolar system of eukaryotic cells. However, there are examples of
V types in eubacteria such as the ntp cluster in Enterococcus hirae.
This cluster is believed to encode a Na-translocating V-type ATPase that
is expressed when the normal F-type ATPase is inoperative.

See TP0424 atpE
See TP0426 atpA
See TP0427 atpB
See TP0428 atpD
See TP0429 atpI
See TP0430 atpK
See TP0527 atpD
See TP0528 atpB
See TP0529 atpA
See TP0530 atpE
See TP0531 atpF
See TP0532 atpK
See TP0533 atpI

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to V-type ATPase,
subunit A. For example residues 26-563 are 63% similar to V-type
ATPase, subunit A of Borrelia burgdorferi,(AE001122).

COGS Summary:  COGS Search
BeTs to 8 clades of COG1155
COG name: Vacuolar ATPase/archaeal ATP synthase A subunit (NtpA)
Functional Class:  C
The phylogenetic pattern of COG1155 is amtKY-----------oLin-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 71-96, 315-326, 334-378, and 405-442 represent significant
(100%) hits to blocks BL00152A,B,C,D, ATP synthase alpha and beta
subunits proteins.

ProDom Summary:  Protein Domain Search
Residues 296-447 are 60% similar to V-type ATPase, subunit A of
ATPA_METBA. Residues 221-267 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0529 V-type ATPase,
subunit A, TP0402, flagellum-specific ATP synthase, TP0528,
V-type ATPase, subunit B, and TP0427 V-type ATPase, subunit B.
Residues 6-504 are 44% similar to TP0529, residues 173-470 are 34%
similar to TP0402, residues 134-501 are 24% similar to TP0528 and
residues 207-410 are 24% similar to TP0427.

Pfam Summary:  Pfam Search
Residues 8 to 72 (E-value = 3.4e-11) place TP0426 in the ATP-synt_ab_N family which is described as ATP synthase alpha/beta family, beta-barrel domain (PF02874)
Residues 258 to 446 (E-value = 2.5e-81) place TP0426 in the ATP-synt_ab family which is described as ATP synthase alpha/beta family, nucleotide-binding domain (PF00006)
Residues 448 to 565 (E-value = 1.2e-10) place TP0426 in the ATP-synt_ab_C family which is described as ATP synthase alpha/beta chain, C terminal domain (PF00306)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
120

PDB Hit:
none

Gene Protein Sequence:
MTQTKGIVSAVNGNMVSVTFEGVVSLNEVGYVHVGNARLKAEIIRVRGRE
AQLQVFEITRGVSVGDRVEFTGDLLSVELGPGLLGQVYDGLQNPLPLLAE
KVGYFLERGVYLPALSRTSEWMFTPHVSVGERVVRGDVLGYTPEGALKHR
IMVPFHMGDSYEVVFIQTAGTYRVHDVIARVRDAQGHEHELTMAFRWPVK
RPVHCYAERLKPTEPLVTSIRTIDTFFPVAKGGTYCIPGPFGAGKTVLQH
STSRNADVDVVVIAACGERAGEVVETLREFPDLTDPRTGRSLMERTVIVC
NTSSMPVASREASVYTGVTLAEYYRQMGLDVLLLADSTSRWAQALREMSG
RLEEIPGEEAFPAYLESCIAAFYERAGVVRLRSGEKGSVTIGGTVSPAGG
NFEEPVTQATLKVVGAFHGLSRERSDARRYPAVHPLDSWSKYPSVLDARA
VAYGRSFLRRGAEVEQMMRVVGEEGTSMEDFLVYLKGSFLDSVYLQQNSF
DTVDSAVPVARQKHCYAIVMRVLGSVLAFESKDDARAYFSKLGHMFIDYN
CCAWNSEAFVEKEKEIRAFLQGESTKIDSEAEGIIRGME

Gene Nucleotide Sequence:  Sequence Viewer
ATGACGCAAACGAAGGGTATCGTGTCTGCGGTCAACGGCAATATGGTGAG
CGTTACGTTCGAGGGTGTCGTTTCGCTCAACGAGGTCGGATACGTGCATG
TTGGAAATGCGCGTTTGAAAGCGGAGATTATTCGTGTTCGTGGTCGTGAG
GCACAGTTGCAAGTGTTTGAGATCACAAGAGGGGTTTCCGTTGGGGACCG
TGTTGAGTTTACAGGCGATTTGCTGTCTGTTGAGCTAGGTCCTGGTTTGC
TCGGTCAGGTGTACGACGGTTTACAGAATCCGTTGCCGCTGCTTGCAGAA
AAGGTTGGGTATTTCTTGGAGCGCGGGGTGTATTTGCCCGCCCTCTCTCG
GACAAGTGAATGGATGTTTACCCCGCATGTTTCAGTGGGTGAGCGCGTGG
TGCGTGGGGACGTGCTCGGGTATACCCCAGAGGGTGCGCTCAAACACCGC
ATTATGGTTCCCTTTCATATGGGGGATTCCTATGAGGTTGTCTTCATTCA
GACTGCAGGGACGTACCGCGTGCACGATGTGATTGCGCGGGTCCGTGACG
CGCAGGGACATGAGCACGAACTGACCATGGCATTTCGTTGGCCAGTGAAG
CGACCCGTCCATTGTTACGCAGAGCGTTTGAAACCGACTGAGCCATTGGT
AACGAGCATTAGGACGATAGATACCTTTTTCCCGGTGGCCAAGGGGGGGA
CGTACTGTATTCCCGGTCCCTTTGGTGCGGGAAAGACGGTGCTGCAGCAT
TCTACCAGTCGCAATGCGGATGTGGACGTGGTAGTGATTGCTGCGTGTGG
GGAGCGTGCAGGGGAGGTGGTTGAGACCCTGCGGGAGTTTCCTGATCTTA
CGGATCCTCGCACTGGTCGGTCGCTTATGGAGCGGACGGTTATAGTGTGC
AACACTTCTTCTATGCCCGTTGCCTCTCGTGAGGCTTCAGTGTACACGGG
AGTGACGCTTGCAGAATATTACCGTCAGATGGGGTTGGATGTTCTTTTGC
TGGCGGACTCTACGAGCCGTTGGGCACAGGCCCTGCGTGAAATGTCTGGG
CGTTTGGAAGAGATTCCGGGGGAGGAGGCCTTTCCTGCGTACCTGGAGTC
TTGTATCGCAGCCTTTTATGAGCGGGCTGGTGTGGTCCGGCTGAGGAGTG
GAGAGAAAGGATCGGTAACTATTGGAGGGACGGTTTCTCCGGCAGGTGGT
AATTTCGAAGAACCGGTAACGCAGGCTACATTGAAAGTGGTTGGGGCGTT
TCACGGACTTTCTCGAGAGCGCTCTGACGCGCGCAGGTATCCTGCGGTGC
ATCCGCTTGATTCATGGTCTAAGTATCCAAGTGTGCTTGACGCGCGGGCT
GTTGCGTACGGTCGCTCTTTTCTGCGCCGTGGGGCAGAGGTGGAGCAGAT
GATGAGGGTCGTCGGCGAAGAGGGCACAAGTATGGAGGACTTTCTCGTAT
ATCTGAAAGGCTCGTTTCTTGATTCGGTGTATCTGCAGCAGAATTCTTTT
GACACAGTCGATAGTGCAGTACCTGTTGCACGTCAAAAGCACTGCTATGC
CATCGTCATGCGGGTTCTTGGCAGTGTTTTAGCGTTTGAATCAAAAGATG
ACGCGCGGGCATACTTCAGCAAGCTTGGGCATATGTTTATCGATTACAAC
TGTTGCGCCTGGAATTCTGAGGCGTTTGTGGAGAAAGAAAAGGAGATACG
TGCCTTTCTCCAGGGAGAATCGACGAAAATCGACAGCGAAGCAGAGGGAA
TTATACGGGGGATGGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy