Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR312 IGR313 IGR309 IGR308 IGR311 IGR310 surE, - TP0419 atpD, - TP0428 atpE, - TP0424 TP0423 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 TP0421 surE, - TP0419 atpD, - TP0428 atpE, - TP0424 TP0423 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 TP0421 Type: tandem, Name:  - 251 Type: tandem, Name:  - 311 atpD, - TP0428 atpE, - TP0424 TP0423 atpB, - TP0427 atpA, - TP0426 atpI, - TP0429 TP0421 TP0420 TP0425 TP0422 TP0422 surE, - TP0419 TP0425 TP0420
* Calculated from Protein Sequence

Gene ID: TP0424

DNA Molecule Name:
1  

Genbank ID:
3322708

Gene Name:
atpE  

Definition:
possible V-type ATPase subunit E

Gene Start:
451930

Gene Stop:
452625

Gene Length:
696

Molecular Weight*:
24962

pI*:
4.95

Net Charge*:
-4.27

EC:
3.6.1.34  

Functional Class:
Energy metabolism; ATP-proton motive force interconversion  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Dzioba J, Häse CC, Gosink K, Galperin MY, Dibrov P.
Experimental verification of a sequence-based prediction: F(1)F(0)-type ATPase of Vibrio cholerae transports protons, not Na(+) ions.
J Bacteriol. 2003 Jan;185(2):674-8.
PMID: 12511516

Koebmann BJ, Nilsson D, Kuipers OP, Jensen PR.
The membrane-bound H(+)-ATPase complex is essential for growth of Lactococcus lactis.
J Bacteriol. 2000 Sep;182(17):4738-43.
PMID: 10940012

Externbrink T, Hujer S, Winzer K, Dürre P.
Sequence analysis of the atp operon of Clostridium acetobutylicum DSM 792 encoding the F0F1 ATP synthase.
DNA Seq. 2000;11(1-2):109-18.
PMID: 10902917

Rahlfs S, Aufurth S, Müller V.
The Na(+)-F(1)F(0)-ATPase operon from Acetobacterium woodii. Operon structure and presence of multiple copies of atpE which encode proteolipids of 8- and 18-kda.
J Biol Chem. 1999 Nov;274(48):33999-4004.
PMID: 10567365

Comment:
V-type ATPases (more correctly the V-F0F1 type ATPases) are one of two
subgroups of the F0F1-ATPases (the other subgroup being the F-F0F1 type).
The V subgroup are found mainly in archaebacteria and the endomembrane
or vacuolar system of eukaryotic cells. However, there are examples of
V types in eubacteria such as the ntp cluster in Enterococcus hirae.
This cluster is believed to encode a Na-translocating V-type ATPase that
is expressed when the normal F-type ATPase is inoperative.

See TP0424 atpE
See TP0426 atpA
See TP0427 atpB
See TP0428 atpD
See TP0429 atpI
See TP0430 atpK

See TP0527 atpD
See TP0528 atpB
See TP0529 atpA
See TP0531 atpF
See TP0532 atpK
See TP0533 atpI

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the middle of this protein had only one
significant hit in the database. Residues 47-174 are 28% similar to
V-type ATPase, subunit E, putative of Borrelia burgdorferi,(AE001122).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
44
transmembrane  
149  
168
transmembrane  
198  
226

PDB Hit:
none

Gene Protein Sequence:
MLGESREEAERIVRAAREEAERIVRAAREEAERIESSSLAALSQASRNVL
LSFQDSVTRSLRAIISMETAQAYDAGVLRELIPRVVSAWVQAEGDKLELI
LSPADLRTLEGVFCAALQEQLSAGVELRSDDCLTAGFRIVPAEGGSYYDF
SAAAVAQLFSSYVSARVAEVLSLLRRSCDVFLLLPYNAATISSMRRGASF
ALSGFFGLCATFLGSAGCCGAWKYLVVSRAGA

Gene Nucleotide Sequence:  Sequence Viewer
TTGCTTGGTGAGTCGCGTGAGGAGGCAGAGCGGATTGTCCGCGCTGCGCG
TGAGGAGGCAGAGCGGATTGTCCGCGCTGCGCGTGAGGAGGCAGAGCGGA
TCGAGTCGTCGTCTCTTGCGGCGCTGTCGCAGGCGAGTCGCAACGTTTTA
TTATCCTTTCAAGATTCGGTGACTCGCTCTCTTCGGGCTATTATTTCGAT
GGAGACGGCGCAAGCCTACGATGCGGGTGTTTTGCGTGAGCTTATTCCTC
GTGTCGTTTCTGCCTGGGTTCAAGCGGAGGGTGATAAGCTAGAGCTCATC
CTCTCTCCTGCTGATCTTCGGACGCTTGAGGGGGTGTTTTGTGCTGCGTT
GCAGGAGCAGCTTTCGGCAGGGGTAGAGTTGAGGTCTGACGATTGCCTTA
CGGCAGGGTTTAGGATAGTCCCTGCCGAGGGCGGGTCGTACTATGATTTT
TCCGCCGCCGCGGTTGCTCAGTTGTTCTCTTCGTATGTTTCTGCGCGTGT
TGCCGAGGTGCTCAGTCTGCTGCGCAGGAGCTGTGATGTCTTCCTATTGC
TACCTTATAACGCAGCTACCATCTCTTCTATGCGGCGCGGTGCCTCCTTT
GCGTTATCAGGATTTTTTGGATTGTGCGCTACGTTTCTTGGGTCGGCAGG
ATGCTGCGGTGCTTGGAAATATCTCGTTGTGTCCCGTGCCGGCGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy