Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR307 IGR309 IGR308 cutE, - TP0417 surE, - TP0419 TP0423 gal1, - TP0418 dagA, - TP0414 TP0421 cutE, - TP0417 surE, - TP0419 TP0423 gal1, - TP0418 dagA, - TP0414 TP0421 Type: tandem, Name:  - 250 cutE, - TP0417 ffh, - TP0416 ffh, - TP0416 surE, - TP0419 gal1, - TP0418 dagA, - TP0414 TP0421 TP0420 TP0415 TP0422 TP0415 TP0422 TP0423 TP0420
* Calculated from Protein Sequence

Gene ID: TP0418

DNA Molecule Name:
1  

Genbank ID:
3322701

Gene Name:
gal1  

Definition:
galactokinase

Gene Start:
445741

Gene Stop:
446931

Gene Length:
1191

Molecular Weight*:
45243

pI*:
8.19

Net Charge*:
6.44

EC:
2.7.1.6  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Carbohydrate metabolism; Galactose metabolism

Comment:
This reaction is the first step of galactose metabolism.

Reaction:
ATP + D-GALACTOSE = ADP + D-GALACTOSE 1-PHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to galactokinase. For
example residues 36-397 are 26% similar to GAL1_BACSU, galactokinase
of Bacillus subtilis,(X73124).

COGS Summary:  COGS Search
BeTs to 7 clades of COG0153
COG name: Galactokinase
Functional Class:  G
The phylogenetic pattern of COG0153 is ---kY-vcebrh-----l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 36-58, 98-108, 120-141, 275-290, 302-331, and 344-357
represent significant (100%) hits to blocks (BL00106A,B,C,F,G,H),
Galactokinase proteins.

ProDom Summary:  Protein Domain Search
Residues 37-371 are 26% similar to galactokinase of GAL1_BACSU.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 120 to 362 (E-value = 6.6e-24) place TP0418 in the GHMP_kinases family which is described as GHMP kinases putative ATP-binding protein (PF00288)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
234  
347

PDB Hit:
none

Gene Protein Sequence:
MLYYFNTLAMMLRMQRVESCHTEEYGDEPEAIAVVPGRFHLLGEYLWFAQ
GNTLSMAIDQTLTLCVSRRKDSTFRLFSLTLGERRKISTANLRYRKEDRW
ANSVKAVILSFMDGGYHLTGLNCTILSQIPPDAGLGTPNALKVAMALVLG
RLFAATLPKESVVSIVEHANERYLKTHAHRADILCVLFAKQGSCVRTDHR
KKQAELCQFPSEGKRIVLTDSRVPRFIAREEFTARLKRCVDAYELVKRNP
DMPRAMSKLMAAALEEIDVPEGIRRRVISLVRESLGVDEAIEALRKRDFA
AFSRVVNRSHERLRDRFEISCPELDWLVKRALEFVDPDAPDVVCSRLTGR
GFGGCTYAILRDQDFEPYLERLDEYERIFGFKAAAYEVQCSEGARVL

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTGTATTATTTCAATACACTGGCTATGATGCTGCGCATGCAGCGGGT
AGAGTCCTGCCACACAGAGGAGTACGGCGACGAGCCTGAGGCGATTGCAG
TCGTTCCGGGTCGTTTTCACCTGTTGGGGGAGTATCTGTGGTTTGCTCAG
GGCAACACCCTGTCGATGGCTATCGATCAAACCCTTACGCTGTGTGTCTC
GCGCCGAAAGGATAGCACCTTTCGCCTTTTCTCCTTAACGCTTGGGGAGC
GGAGGAAGATTTCCACCGCTAATTTACGCTATCGTAAGGAGGATCGCTGG
GCTAATTCGGTAAAGGCGGTCATTCTCTCCTTCATGGATGGTGGGTATCA
CCTGACGGGGTTGAACTGCACTATCCTTTCTCAGATTCCTCCTGATGCGG
GGCTGGGTACTCCCAATGCGCTGAAGGTTGCCATGGCCCTTGTGCTTGGA
AGGTTGTTTGCCGCTACGCTGCCAAAGGAAAGTGTTGTTTCGATCGTGGA
ACACGCAAATGAGCGCTATCTCAAGACCCACGCACATCGCGCGGATATTC
TGTGCGTGTTGTTTGCAAAGCAGGGTAGCTGCGTGCGCACTGATCACCGC
AAGAAGCAGGCGGAACTGTGTCAATTTCCCTCGGAGGGGAAGCGTATTGT
GCTTACTGACTCGCGTGTTCCCCGTTTCATCGCGCGTGAGGAGTTCACCG
CGCGTTTGAAGCGTTGCGTGGATGCTTATGAATTGGTGAAGCGCAATCCC
GATATGCCTCGCGCTATGTCTAAGCTCATGGCAGCAGCGTTGGAGGAAAT
AGATGTGCCTGAGGGAATACGGAGGCGAGTGATCAGTTTGGTGCGCGAGT
CGCTGGGCGTTGATGAGGCGATTGAAGCCCTGCGTAAGCGGGATTTTGCT
GCGTTCTCAAGAGTAGTGAACCGCTCTCATGAGCGCCTGCGGGACCGCTT
TGAAATTTCTTGTCCAGAACTCGATTGGTTGGTGAAGCGTGCGCTTGAGT
TTGTAGATCCTGATGCGCCGGATGTGGTCTGCTCGCGCCTCACGGGTCGG
GGCTTTGGTGGGTGCACCTATGCGATTTTGCGCGATCAAGACTTTGAGCC
GTACCTAGAAAGGCTCGACGAGTACGAGCGCATCTTCGGTTTCAAAGCAG
CGGCGTATGAGGTACAGTGCTCTGAAGGGGCCCGGGTGTTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy