Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR307 IGR306 IGR308 cutE, - TP0417 femD, - TP0413 surE, - TP0419 gal1, - TP0418 dagA, - TP0414 TP0421 cutE, - TP0417 femD, - TP0413 surE, - TP0419 gal1, - TP0418 dagA, - TP0414 TP0421 Type: tandem, Name:  - 98 Type: tandem, Name:  - 250 cutE, - TP0417 femD, - TP0413 ffh, - TP0416 ffh, - TP0416 TP0422 surE, - TP0419 gal1, - TP0418 dagA, - TP0414 TP0421 TP0420 TP0415 TP0422 TP0415 TP0420
* Calculated from Protein Sequence

Gene ID: TP0417

DNA Molecule Name:
1  

Genbank ID:
3322700

Gene Name:
cutE  

Definition:
apolipoprotein N-acyltransferase

Gene Start:
445714

Gene Stop:
444038

Gene Length:
1677

Molecular Weight*:
61141

pI*:
9.76

Net Charge*:
19.47

EC:
2.3.1.-  

Functional Class:
Cell envelope; Membranes, lipoproteins, and porins  

Pathway: pathway table
Nucleotide metabolism; Aminosugars metabolism

Comment:
This protein transfers the fatty acyl group on membrane lipoproteins.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to both apolipoprotein
N-acyltransferases and acid-inducible proteins. For example residues
114-541 are 25% similar to LNT_ECOLI, apolipoprotein N-acyltransferase
of E. coli,(U82598) and residues 20-534 are 27% similar to acid-inducible
protein (act206) of Borrelia burgdorferi,(AE001134).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0815
COG name: Apolipoprotein N-acyltransferase
Functional Class:  M
The phylogenetic pattern of COG0815 is -----qvce-Rhuj--oLinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 276-541 are 33% similar to apolipoprotein N-acyltransferase
of LNT_ECOLI. Residues 41-263 also support this match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0252 a putative apolipoprotein
N-acyltransferase. Residues 16-541 are 27% similar to TP0252.

Pfam Summary:  Pfam Search
Residues 250 to 441 (E-value = 2.5e-06) place TP0417 in the CN_hydrolase family which is described as Carbon-nitrogen hydrolase (PF00795)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
14
transmembrane  
26  
47
transmembrane  
57  
73
transmembrane  
80  
106
transmembrane  
154  
175
non-globular  
208  
356

PDB Hit:
none

Gene Protein Sequence:
MLCTAPLVSSAASAVLLAFAIPNEFWLAGSSVLGLGALVPLYVGFLLSPA
KKHVACSYGLFVALVHACSSFWLKNFQGFALFTLGASTVGYFFYALPFGV
AFACILRKQAPARACAFALVWTLWEWVKSTGILAYPWGTVPMTAHSLSHL
IQIADITGVWGLSFLIPLANACVAESLHFFIKKRDSVPVFRLWLLTGCLY
CLCSLYGAYRIATLGAPRTTLALAIVQQNADPWDTXSFEKNLTTAIHLTE
TALRTQTAPPLPTTPYRKEKTLTHASARAPVDMVVWSESSLRYPYEQYRH
VYNALPAARPFSAFLRTLGAPLLVGTPLRLSGNSTKGGYANAVALLRPDG
HVAQVYGKMQMVPFAEFIPWGHMTSVQRLAQMLAGFSESWTPGPGPRLFH
VPCAAGGSVRFATPICYEDAFPSLCAALHTQGSELLINLTNDSWSKTASA
EWQHYVVSLFRAIELRTTLVRSTNSGYTVVIGPEGKTRAAFPLFQATSAV
LHVPVYPVVRTYYARMRDWVIVLCALIFFAEGVRMAVHTRRHSTTQAESS
LQQIRGEHV

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTTGCACAGCGCCTCTTGTTTCAAGCGCCGCCTCGGCGGTGCTCTT
GGCATTTGCGATTCCCAACGAGTTTTGGCTCGCCGGTTCCTCCGTGCTAG
GGTTGGGGGCGCTTGTTCCCTTGTACGTTGGATTCCTCCTCTCCCCTGCA
AAAAAACACGTTGCCTGTTCTTATGGGCTGTTCGTCGCACTCGTGCACGC
GTGTTCTAGCTTTTGGCTCAAAAACTTTCAGGGCTTCGCGCTCTTCACCC
TCGGCGCATCAACTGTCGGTTACTTCTTCTATGCGCTTCCTTTCGGCGTA
GCGTTCGCATGCATCCTGCGCAAGCAGGCGCCCGCGCGTGCCTGCGCTTT
TGCGCTCGTGTGGACCCTCTGGGAATGGGTAAAGTCAACCGGTATACTCG
CCTACCCGTGGGGTACGGTCCCTATGACCGCGCACAGCCTCTCGCACCTC
ATACAGATAGCTGATATCACCGGCGTCTGGGGGCTTTCCTTCCTCATCCC
GCTCGCAAACGCGTGCGTTGCAGAAAGTCTCCACTTCTTCATAAAAAAGA
GAGACAGCGTCCCTGTGTTCCGTCTCTGGCTCCTCACCGGCTGCTTGTAC
TGCCTGTGCAGTCTCTACGGTGCCTACCGCATCGCCACCCTTGGGGCTCC
ACGTACCACGCTCGCGTTGGCAATCGTACAGCAAAATGCAGATCCGTGGG
ATACAAYTTCCTTCGAAAAAAACCTCACCACCGCTATACATCTGACTGAG
ACAGCCCTTCGTACGCAAACAGCTCCCCCCCTGCCGACTACTCCCTACAG
AAAAGAAAAAACACTCACACACGCTTCTGCGCGCGCACCTGTCGACATGG
TGGTTTGGAGCGAGTCTAGTCTGCGCTATCCGTACGAACAGTACCGTCAC
GTGTATAACGCATTGCCAGCGGCACGACCTTTCTCGGCGTTCTTGCGCAC
GCTCGGCGCGCCCCTTCTGGTGGGAACCCCCTTGAGACTGTCTGGTAACT
CCACTAAAGGTGGATACGCCAATGCAGTGGCCTTGCTCCGCCCAGACGGG
CACGTGGCGCAGGTATATGGCAAAATGCAGATGGTGCCATTTGCAGAATT
CATTCCCTGGGGACACATGACATCTGTACAAAGACTGGCGCAGATGCTCG
CCGGCTTTTCCGAAAGCTGGACGCCAGGGCCAGGGCCGCGCTTGTTTCAT
GTGCCGTGCGCCGCAGGAGGCAGCGTGCGCTTCGCAACTCCCATCTGTTA
CGAAGATGCCTTTCCTTCCCTCTGCGCCGCTTTGCACACACAGGGGAGTG
AGCTCCTTATTAATCTTACGAACGACTCTTGGTCAAAAACTGCCAGCGCA
GAGTGGCAGCACTATGTTGTCTCTCTTTTTCGGGCCATAGAGCTGCGTAC
CACCCTCGTGCGCTCTACAAACTCTGGCTATACCGTCGTCATCGGCCCAG
AGGGAAAAACGCGCGCCGCGTTTCCGTTGTTTCAGGCCACCAGCGCGGTG
CTCCACGTTCCAGTGTACCCGGTAGTGCGCACGTACTATGCGCGCATGAG
AGATTGGGTGATCGTGCTGTGCGCGCTCATCTTTTTTGCAGAAGGAGTGC
GCATGGCCGTGCACACCCGCCGGCACAGCACCACGCAGGCGGAAAGCTCA
CTGCAGCAGATAAGGGGGGAGCATGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy