Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR305 IGR302 IGR304 IGR306 IGR303 TP0412 cutE, - TP0417 femD, - TP0413 TP0409 secF, - TP0411 dagA, - TP0414 secD, - TP0410 TP0408 TP0412 cutE, - TP0417 femD, - TP0413 TP0409 secF, - TP0411 dagA, - TP0414 secD, - TP0410 TP0408 Type: tandem, Name:  - 98 Type: tandem, Name:  - 250 TP0412 cutE, - TP0417 femD, - TP0413 ffh, - TP0416 ffh, - TP0416 secF, - TP0411 dagA, - TP0414 secD, - TP0410 TP0408 TP0415 TP0415 TP0409
* Calculated from Protein Sequence

Gene ID: TP0413

DNA Molecule Name:
1  

Genbank ID:
3322697

Gene Name:
femD  

Definition:
phosphoglucomutase

Gene Start:
440765

Gene Stop:
438870

Gene Length:
1896

Molecular Weight*:
70054

pI*:
7.90

Net Charge*:
7.96

EC:
5.4.2.2  

Functional Class:
Central intermediary metabolism; Polysaccharides  

Pathway: pathway table
Carbohydrate metabolism; Galactose metabolism
Carbohydrate metabolism; Glycolysis / Gluconeogenesis
Metabolism of complex carbohydrates; Starch and sucrose metabolism

Secondary Evidence:
Jolly L, Wu S, van Heijenoort J, de Lencastre H, Mengin-Lecreulx D, Tomasz A.
The femR315 gene from Staphylococcus aureus, the interruption of which results in reduced methicillin resistance, encodes a phosphoglucosamine mutase.
J Bacteriol. 1997 Sep;179(17):5321-5.
PMID: 9286983

Wu S, de Lencastre H, Sali A, Tomasz A.
A phosphoglucomutase-like gene essential for the optimal expression of methicillin resistance in Staphylococcus aureus: molecular cloning and DNA sequencing.
Microb Drug Resist. 2(2):277-86.
PMID: 9158773

Comment:
Reaction:
ALPHA-D-GLUCOSE 1-PHOSPHATE <=> ALPHA-D-GLUCOSE 6-PHOSPHATE

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the entire protein hits has only one significant
hit in the database to phosphoglucomutase (femD) of Borrelia burgdorferi,
(AE001115) while the N-terminal region has many hits to hypothetical
proteins, phosphoglucomutases and phosphomannomutases. Residues 27-621
are 33% similar to the FemD protein of B. burgdorferi.

COGS Summary:  COGS Search
BeTs to 16 clades of COG1109
COG name: Phosphomannomutase
Functional Class:? G
The phylogenetic pattern of COG1109 is aMTKYQVCEBRHUJgpOLINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 125-134, 313-324, and 577-594 represent significant (98%)
hits to blocks (BL00710B,C,D), Phosphoglucomutase and phosphomannomutase
phosphoserine signal.

ProDom Summary:  Protein Domain Search
Residues 58-142 are 31% similar to putative urease protein of
UREC_HELPY in the prodom group that also contains phosphoglucomutase
and phosphomannomutase. Residues 54-152 are 32% similar to Y740_HAEIN,
a hypothetical protein with similarity to phosphoglucomutase and
phosphomannomutase.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0642 phosphomannomutase
(manB). Residues 48-164 are 26% similar to TP0642.

Pfam Summary:  Pfam Search
Residues 25 to 169 (E-value = 9.3e-19) place TP0413 in the PGM_PMM_I family which is described as Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I (PF02878)

PDB Hit:
none

Gene Protein Sequence:
MSLLNSLITSLTLPQPAQPLHLSLTRSPSGWRKVFPYAFTPERTVTLTQK
ADAVLSAQVALSYARFLKKKVPKPRVVIARDSRPTGEIISSICTAILHLE
GCSLRCVGVGPIPEIASYARNYDAFLYISASHNPIEYNGFKFGLNDGGVL
SPTQAQQLSEDFVAQCLQPASFQKIREHCATLNASILEPLLYNKTHKQES
LHSYDLFIREVIANSPKETEHRAFFHRFTQQRAAYSEQGTPLSILIDFNG
SARAASIDRRLLESLGVALFSIAETPGDIRHRIVPEGSSLTACAQALTEA
ATRGSSPEERSIAFGFVPDCDGDRGNIVYYDQTLNRAVIPHEQAVFALSV
VSEICELSRNLRMQPHRAPPIALVTNGPTSLRVEAIAQLLDVHVFRTEVG
EAHLIEKAHLLRKEGYCVRILGEGSNGGSILHPAAVRDPLHTVFALLKLL
LLRGDGKQPGLFAWWCAHSHQTERAQHAFTISDLFASLPAYTTTPTHDTR
ALLQIRTTDHALLKSAYQRVFERRWAQEKDTLKKRFGICSYRPILYRGRE
QQDAAGDFSRSADGGLKIQFYNEHQEAVAFVWMRGSKTEPIFRISADLKG
NDEAGEAALLQLHADMVREADRCALSCADTTS

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCCTGCTCAACTCACTCATCACCTCCCTCACCTTGCCGCAGCCTGC
GCAGCCGCTTCATCTATCACTCACCCGGTCACCCTCAGGGTGGCGCAAGG
TTTTCCCCTACGCTTTTACCCCTGAGCGCACCGTCACCCTCACGCAAAAG
GCTGACGCTGTACTCAGCGCACAGGTAGCACTCAGCTACGCCCGATTCTT
GAAAAAAAAGGTCCCAAAACCACGTGTTGTCATCGCGCGCGACTCGCGCC
CTACTGGAGAGATTATCAGTTCTATCTGCACCGCTATCCTCCATCTGGAA
GGCTGTTCGCTGCGTTGTGTCGGAGTCGGACCAATACCCGAAATTGCAAG
CTACGCGAGGAACTACGACGCTTTCCTCTACATCTCCGCAAGTCACAATC
CTATCGAATACAATGGCTTTAAATTTGGCCTAAATGACGGCGGCGTGCTC
AGTCCTACTCAGGCACAACAGCTGAGCGAAGACTTCGTCGCACAGTGTTT
ACAGCCCGCCTCTTTCCAGAAAATACGAGAGCATTGTGCCACGCTCAACG
CCTCTATACTCGAACCGCTGCTGTACAACAAAACACACAAACAAGAAAGC
CTGCACAGCTATGATCTCTTCATAAGGGAAGTGATCGCAAATTCCCCTAA
AGAAACTGAGCACCGTGCCTTTTTCCATCGCTTTACCCAGCAGCGTGCCG
CCTACAGCGAACAGGGAACACCCCTGTCTATCCTCATTGATTTCAATGGA
AGTGCGCGTGCAGCTTCCATAGATAGGCGCCTCCTAGAATCACTCGGTGT
CGCCCTTTTTAGTATCGCCGAAACGCCAGGGGATATTCGCCATCGCATAG
TTCCTGAAGGGTCCTCTCTTACCGCGTGCGCGCAGGCACTGACCGAGGCA
GCCACGCGAGGTTCATCCCCAGAAGAACGCTCCATTGCCTTCGGCTTTGT
GCCAGATTGTGACGGAGATCGGGGAAATATTGTCTATTACGACCAAACCC
TTAATCGCGCTGTCATTCCGCACGAACAGGCAGTCTTTGCTCTTTCGGTT
GTGTCGGAGATCTGTGAACTCAGTCGCAACCTCCGTATGCAGCCACACCG
CGCGCCGCCTATCGCGCTGGTTACCAATGGTCCCACCTCGCTGCGTGTAG
AAGCTATCGCGCAGCTCTTAGACGTGCACGTTTTTCGCACGGAGGTAGGA
GAGGCGCACCTCATTGAGAAGGCACACCTTCTACGGAAAGAAGGCTACTG
CGTGCGCATTCTAGGGGAAGGATCAAACGGGGGCAGCATTCTCCATCCGG
CGGCAGTACGTGATCCTTTGCATACTGTTTTTGCACTCTTAAAGCTCTTG
CTCCTGCGGGGGGATGGGAAACAGCCAGGACTCTTTGCCTGGTGGTGCGC
GCACTCACACCAAACAGAACGCGCGCAGCATGCCTTCACGATATCGGATC
TATTTGCCAGCCTACCTGCGTACACGACTACACCAACGCACGATACGCGC
GCGCTCTTGCAGATACGAACGACTGACCATGCACTCCTCAAGAGCGCATA
TCAGCGGGTATTTGAACGCAGGTGGGCGCAGGAGAAAGACACGTTAAAAA
AACGCTTCGGCATTTGTTCGTACCGCCCGATATTGTACCGCGGGAGGGAG
CAGCAGGACGCGGCGGGGGATTTTAGCCGGTCGGCTGACGGAGGATTGAA
AATCCAATTTTACAACGAGCACCAAGAAGCGGTGGCGTTCGTGTGGATGC
GCGGTTCAAAGACAGAACCAATATTTAGAATTTCTGCGGATCTGAAAGGT
AATGACGAGGCGGGGGAAGCTGCGCTTTTGCAGCTGCACGCGGACATGGT
GCGCGAGGCAGATCGCTGTGCGCTTTCGTGTGCGGATACGACTTCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy