Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR298 IGR296 IGR297 IGR302 IGR295 IGR301 IGR300 IGR299 IGR303 TP0405 TP0404 TP0409 fliJ, - TP0403 TP0407 murI, - TP0406 fliH, - TP0401 fliG, - TP0400 fliI, - TP0402 TP0408 TP0405 TP0404 TP0409 fliJ, - TP0403 TP0407 murI, - TP0406 fliH, - TP0401 fliG, - TP0400 fliI, - TP0402 TP0408 Type: tandem, Name:  - 97 TP0404 TP0405 TP0409 fliJ, - TP0403 TP0407 murI, - TP0406 fliH, - TP0401 fliG, - TP0400 fliI, - TP0402 TP0408
* Calculated from Protein Sequence

Gene ID: TP0406

DNA Molecule Name:
1  

Genbank ID:
3322687

Gene Name:
murI  

Definition:
glutamate racemase

Gene Start:
430026

Gene Stop:
430829

Gene Length:
804

Molecular Weight*:
29435

pI*:
8.40

Net Charge*:
8.59

EC:
5.1.1.3  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Miscellaneous Enzymes

Secondary Evidence:
Glavas S, Tanner ME.
Active site residues of glutamate racemase.
Biochemistry. 2001 May;40(21):6199-204.
PMID: 11371180

Malathi KC, Wachi M, Nagai K.
Isolation of the murI gene from Brevibacterium lactofermentum ATCC 13869 encoding D-glutamate racemase.
FEMS Microbiol Lett. 1999 Jun;175(2):193-6.
PMID: 10386367

Hwang KY, Cho CS, Kim SS, Sung HC, Yu YG, Cho Y.
Structure and mechanism of glutamate racemase from Aquifex pyrophilus.
Nat Struct Biol. 1999 May;6(5):422-6.
PMID: 10331867

Liu L, Yoshimura T, Endo K, Esaki N, Soda K.
Cloning and expression of the glutamate racemase gene of Bacillus pumilus.
J Biochem (Tokyo). 1997 Jun;121(6):1155-61.
PMID: 9354391

Comment:
This protein is involved in peptidoglycan biosynthesis, specifically
it provides the (R)-glutamic acid cell wall biosynthensis.

Reaction:
L-GLUTAMATE = D-GLUTAMATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to glutamate racemases.
For example residues 14-221 are 32% similar to MURI_ECOLI, glutamate
racemase of E. coli,(L14556).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0796
COG name: Glutamate racemase
Functional Class:? M
The phylogenetic pattern of COG0796 is -----q-ceBrhuj--ol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 13-22, 39-49, 71-82, 183-194, 107-120, and 175-201 represent
significant (99%) hits to blocks (BL00923A,B,C,D,E), Aspartate and
glutamate racemases proteins. Residues 38-57 represent significant
(97%) but unlikely hits to blocks (PR00494F), FANCONI'S ANAEMIA-
ASSOCIATED PROTEIN SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 14-221 are 33% similar to glutamate racemase of MURI_ECOLI.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 9 to 226 (E-value = 1.2e-75) place TP0406 in the Asp_Glu_race family which is described as Asp/Glu/Hydantoin racemase (PF01177)

PDB Hit:
none

Gene Protein Sequence:
MSDRREQFQYAFLDSGIGGLPYAHALRVRVPEASLVYVADRVYFPYGNKS
SAQIIARASAVLQKVQTNFSPHIVVLACNSMSVNALEFLRAQVSVPVVGV
VPAIKQAVACSHKKHIGVLATQCTITHPYTACLRAQFGAGCVFQMRADAR
LIECLERGLIFEVEDMQREAVARSVMPFQEAGVDVLVLACTHFVHVRHLF
QDCVGTSCTVVDSLEGVVRRTLRLCPPQSQLRGNAACYVTGARDAVCAAR
YARYAQHFGLRWAGFLDV

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCGGACCGACGTGAGCAATTTCAATACGCATTTTTGGATTCAGGTAT
AGGAGGATTGCCCTACGCACACGCCTTACGCGTGCGTGTGCCTGAGGCCT
CACTGGTGTACGTGGCGGACCGTGTATACTTTCCTTATGGGAATAAAAGT
TCTGCACAGATTATTGCGCGTGCGTCTGCAGTTTTGCAGAAAGTGCAGAC
GAATTTTTCACCACACATAGTGGTACTCGCGTGTAACAGCATGTCTGTCA
ATGCACTTGAGTTTTTGCGTGCGCAGGTTTCGGTTCCAGTGGTGGGGGTG
GTGCCTGCAATTAAGCAGGCGGTGGCGTGCAGTCATAAAAAGCACATTGG
TGTCTTAGCTACACAATGCACGATTACGCATCCGTACACAGCGTGTTTGA
GAGCACAGTTTGGTGCAGGGTGTGTGTTTCAGATGCGTGCGGATGCACGC
CTTATTGAGTGTCTTGAGCGCGGGTTAATTTTTGAAGTCGAAGACATGCA
GCGGGAGGCAGTGGCGCGCTCAGTTATGCCCTTCCAGGAAGCGGGGGTGG
ATGTGCTCGTGCTCGCGTGCACCCATTTTGTGCACGTGCGTCATCTTTTT
CAGGACTGTGTTGGTACCTCGTGTACGGTGGTAGATTCGCTAGAAGGTGT
GGTACGCAGGACGTTACGTCTGTGTCCACCGCAATCTCAATTGCGTGGGA
ACGCCGCCTGTTACGTAACTGGTGCGCGCGATGCAGTGTGCGCGGCACGA
TACGCACGGTATGCGCAGCACTTTGGATTGCGCTGGGCGGGTTTTTTGGA
CGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy