Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR298 IGR294 IGR296 IGR297 IGR295 IGR292 IGR301 IGR293 IGR300 IGR299 TP0405 TP0404 fliE, - TP0398 flgC, - TP0397 fliJ, - TP0403 TP0407 murI, - TP0406 fliH, - TP0401 fliG, - TP0400 fliI, - TP0402 fliF, - TP0399 TP0408 TP0405 TP0404 fliE, - TP0398 flgC, - TP0397 fliJ, - TP0403 TP0407 murI, - TP0406 fliH, - TP0401 fliG, - TP0400 fliI, - TP0402 fliF, - TP0399 TP0408 Type: tandem, Name:  - 96 Type: tandem, Name:  - 97 TP0404 TP0405 flgC, - TP0397 fliJ, - TP0403 TP0407 murI, - TP0406 fliH, - TP0401 fliG, - TP0400 fliI, - TP0402 fliF, - TP0399 TP0408 fliE, - TP0398
* Calculated from Protein Sequence

Gene ID: TP0402

DNA Molecule Name:
1  

Genbank ID:
3322685

Gene Name:
fliI  

Definition:
flagellum-specific ATP synthase

Gene Start:
427035

Gene Stop:
428375

Gene Length:
1341

Molecular Weight*:
47841

pI*:
6.64

Net Charge*:
-1.47

EC:
3.6.1.34  

Functional Class:
Cell envelope; Surface structures  

Pathway: pathway table
Membrane transport; Type III secretion
Molecular assembly; Flagellar assembly
Nucleotide metabolism; Purine Metabolism

Primary Evidence:
Heinzerling HF, Olivares M, Burne RA. 1997. Genetic and transcriptional analysis of flgB flagellar operon
constituents in the oral spirochete Treponema denticola and
their heterologous expression in enteric bacteria. Infect Immun Jun;65(6):2041-51. Medline: 97313126.

Comment:
This protein is a probable catalytic subunit of a protein translocase
for flagellum-specific export, or a protein translocase involved in
local circuits at the flagellum.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to flagellum-specific
ATP synthase (fliI). For example residues 4-444 are 56% similar to
FliI of Treponema denticola,(U78776).

COGS Summary:  COGS Search
BeTs to 8 clades of COG1157
COG name: Flagellar ATPase-like component
Functional Class:  C
The phylogenetic pattern of COG1157 is -----qv-eb--uj--olIN-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 89-114, 236-247, 255-299 and 321-358 represent significant
(100%) hits to blocks (BL00152A,B,C,D), ATP synthase alpha and beta
subunits proteins.

ProDom Summary:  Protein Domain Search
Residues 217-389 are 58% similar to YSCN_YEREN, a hypothetical protein
with similarity to ATP synthases. Residues 148-195 also support this
match.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0528, TP0427, TP0426,
and TP0529 all of which are V-type ATPases. It is also paralogously
related to TP0254 transcription termination factor Rho.
Residues 31-421 are 29% similar to TP0528. Residues 25-434 are 26%
similar to TP0427. Residues 104-390 are 34% similar to TP0426.
Residues 136-362 are 30% similar to TP0529. Residues 134-378 are
26% similar to TP0254.

Pfam Summary:  Pfam Search
Residues 25 to 90 (E-value = 3.2e-09) place TP0402 in the ATP-synt_ab_N family which is described as ATP synthase alpha/beta family, beta-barrel domain (PF02874)
Residues 186 to 362 (E-value = 2.7e-102) place TP0402 in the ATP-synt_ab family which is described as ATP synthase alpha/beta family, nucleotide-binding domain (PF00006)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
132
non-globular  
311  
447

PDB Hit:
gi|1943080|pdb|1BMF|A Bos taurus

Gene Protein Sequence:
MEADLLCKYEVALRESEPVKYVGHVTAVRGLLIESRGPHAVVGELCRIVL
RRQGRPLIAEVVGLAGSTVKLMSYTDTHGVEVGCAVVAEGAALSVPVGDA
LLGRVLNAFGKAIDGKGEIYAPLRSEVLRASSNPMERLPITRQMVTGVRV
LDSLLAVGCGQRLGIFSGSGVGKSTLMGMIARNTDADVSVIALIGERGRE
VMDFVAHDLGPEGLKRSVIVSATSDESPLARVRGAYTATAIAEYFRDQGK
QVLLLFDSLTRFAKAQREIGLASGELPATRGYTPGVFETLPKLLERAGSF
SMGSVTAFYTVLVDGDDLDEPISDAVRGIVDGHIVLSRALAQRNHYPAID
VLQSVSRLAHRVLGADMKEAVRIVRRALAVYAEVEDLVRVGAYQQGSDAE
LDRAIAMRAELERFLTQGAQERVRFQDTVTSLSMLTGLSIAQPPSGV

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAGCAGACCTGTTGTGCAAGTATGAGGTGGCGCTCCGCGAGAGTGA
GCCGGTAAAGTACGTTGGGCATGTGACAGCAGTGAGGGGTTTATTGATTG
AAAGTCGTGGCCCTCACGCGGTAGTTGGTGAATTGTGTCGGATTGTGTTG
CGCCGCCAGGGGCGACCGTTGATAGCAGAGGTAGTAGGACTTGCAGGATC
GACGGTAAAACTGATGAGCTACACCGATACGCACGGGGTTGAAGTTGGCT
GTGCGGTGGTAGCAGAAGGGGCGGCACTTTCAGTCCCCGTAGGAGATGCT
TTACTCGGACGCGTTTTGAACGCGTTTGGGAAGGCAATTGACGGGAAGGG
GGAGATATATGCGCCGCTCCGCTCCGAGGTGTTGCGCGCGTCTTCTAATC
CTATGGAGCGTCTTCCGATTACGCGTCAAATGGTAACAGGAGTGCGGGTG
CTTGATTCGTTGCTGGCAGTTGGTTGCGGACAACGTCTGGGTATTTTTTC
CGGTTCGGGGGTTGGGAAGTCGACGCTGATGGGGATGATCGCGCGCAATA
CAGACGCAGATGTGTCGGTCATTGCCCTTATCGGGGAGCGTGGCCGTGAA
GTGATGGATTTTGTTGCGCATGATTTGGGTCCTGAGGGTTTGAAGCGCTC
GGTAATAGTTAGTGCGACGTCTGATGAAAGTCCGCTTGCGCGGGTACGAG
GTGCGTACACGGCGACAGCGATTGCAGAGTACTTTCGGGATCAAGGCAAA
CAGGTGCTGCTGCTGTTTGATTCTCTGACGCGCTTTGCAAAAGCTCAGCG
TGAGATTGGGTTAGCGTCGGGGGAGCTCCCTGCAACGCGTGGATATACCC
CGGGGGTATTCGAAACGTTACCGAAACTGCTTGAGCGTGCAGGTTCTTTT
TCCATGGGGAGCGTCACCGCTTTTTATACTGTTTTGGTAGATGGGGACGA
TCTCGATGAGCCGATATCAGACGCCGTGCGTGGAATTGTAGACGGGCACA
TTGTACTCAGTCGCGCGCTTGCGCAGCGCAATCACTATCCTGCAATAGAC
GTGTTGCAAAGCGTTTCTCGCTTGGCGCACCGCGTGCTGGGTGCAGACAT
GAAAGAGGCAGTGCGCATAGTGCGTCGTGCGCTTGCAGTGTACGCAGAAG
TAGAGGATTTGGTACGAGTTGGTGCGTACCAGCAGGGGAGTGATGCAGAA
CTTGATCGAGCTATTGCGATGCGCGCAGAGCTTGAACGGTTCCTAACGCA
AGGAGCCCAGGAGCGCGTGCGTTTTCAGGATACTGTAACGTCGCTGTCCA
TGCTGACAGGGCTCAGTATAGCACAGCCGCCTTCGGGTGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy