Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Gln-2 IGR274 IGR277 IGR275 IGR276 IGR278 TP0370 TP0368 ctc, - TP0372 TP0371 TP0369 TP0374 TP0367 TP0370 TP0368 ctc, - TP0372 TP0371 TP0369 TP0374 TP0367 Type: tandem, Name:  - 86 Type: tandem, Name:  - 293 Type: tandem, Name:  - 310 TP0370 TP0368 ctc, - TP0372 TP0371 TP0369 TP0374 TP0367 TP0373 TP0373
* Calculated from Protein Sequence

Gene ID: TP0371

DNA Molecule Name:
1  

Genbank ID:
3322649

Gene Name:


Definition:
conserved hypothetical protein/ possible homoserine kinase

Gene Start:
394779

Gene Stop:
395651

Gene Length:
873

Molecular Weight*:
31466

pI*:
8.99

Net Charge*:
11.40

EC:
2.7.1.39  

Functional Class:
Conserved hypothetical  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
Reaction for homoserine kinase:
ATP + L-HOMOSERINE = ADP + O-PHOSPHO-L-HOMOSERINE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to hypothetical proteins.
For example residues 7-274 are 26% similar to YABH_BACSU, HYPOTHETICAL
31.7 KD PROTEIN IN SSPF-PURR INTERGENIC REGION of Bacillus subtilis,
(D26185). Several iterations of PSI-BLAST revealed some limited homology
to KHSE_ECOLI, homoserine kinase of Escherichia coli, (L13601). Residues
38-281 are 18% similar to KHSE_ECOLI.

COGS Summary:  COGS Search
BeTs to 8 clades of COG1947
COG name: Uncharacterized ACR, YchB/YabH family
Functional Class:  S
The phylogenetic pattern of COG1947 is -----qvcebrhuj---li--
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 10-165 are 26% similar to YCHB_ECOLI, a hypothetical protein.
Residues 220-291 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 84 to 268 (E-value = 3.2e-24) place TP0371 in the GHMP_kinases family which is described as GHMP kinases putative ATP-binding protein (PF00288)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
68  
211

PDB Hit:
none

Gene Protein Sequence:
MQSLSLRAHAKVNMHLWVGARRADGLHSIESVMQRITLADSLSLSRLDIP
GRCEVCSPYMALPRENTLTRAYARFCQVTGVHDGVRVRVVKRIPAGSGLG
GGSADAAALLCGLDTLFGTTLSARVLREVAYSVGSDVPFFLASQAACVLG
GGEQLVPLVPKTGYLGLLVWPGLHSGSAQAYEDLDRLRACGVHAADGEQY
SLRGATALSAHYAQDCARWRFFNSLDAPVQRRYPVVALARWDLARAGACF
TAMSGSGSXVFGLYRDEEELRRAHKLLAKRWCWCVRVRLCG

Gene Nucleotide Sequence:  Sequence Viewer
GTGCAGTCGCTGAGTTTGCGCGCTCACGCAAAGGTGAACATGCATCTGTG
GGTTGGTGCACGTCGGGCCGATGGTCTTCACTCGATTGAGAGTGTAATGC
AGCGCATTACGCTTGCGGATTCTTTGTCTCTTTCGCGCCTGGATATCCCT
GGCCGGTGTGAGGTGTGTTCGCCTTATATGGCTCTGCCTCGAGAAAACAC
GCTGACCCGTGCGTATGCGCGGTTTTGTCAGGTAACTGGCGTTCACGATG
GTGTGCGCGTGCGCGTAGTGAAGCGTATCCCTGCAGGGTCTGGACTTGGT
GGGGGGTCTGCTGATGCTGCCGCGCTTTTGTGTGGCCTTGATACGTTGTT
TGGGACGACCCTTTCTGCTCGGGTTCTACGAGAAGTGGCGTATAGTGTCG
GCAGTGATGTCCCTTTTTTCCTGGCTTCCCAGGCTGCGTGCGTGCTAGGT
GGTGGTGAGCAGCTCGTTCCCCTTGTTCCAAAGACTGGCTATCTGGGGCT
TTTGGTCTGGCCGGGATTGCACAGCGGTTCTGCACAGGCCTATGAGGATT
TGGACAGGTTGCGTGCGTGCGGCGTACATGCTGCCGACGGCGAGCAGTAC
TCTCTGCGTGGGGCTACCGCGCTTTCTGCGCACTATGCACAGGATTGTGC
GCGGTGGCGGTTTTTTAATAGCTTAGATGCCCCTGTACAGCGTCGGTACC
CTGTAGTCGCCCTTGCGCGTTGGGATCTGGCCCGTGCGGGTGCGTGCTTT
ACAGCGATGAGTGGAAGCGGGAGCSCGGTTTTTGGTCTGTATCGGGATGA
GGAGGAGCTTCGGCGCGCGCATAAGCTGCTTGCAAAGCGGTGGTGTTGGT
GTGTGCGTGTCCGGTTATGTGGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy