Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR268 IGR266 IGR272 IGR271 IGR269 IGR267 IGR273 IGR270 TP0359 plsC, - TP0361 TP0358 TP0360 rpmB, - TP0362 cheY, - TP0366 cheX, - TP0365 cheA, - TP0363 TP0367 TP0359 plsC, - TP0361 TP0358 TP0360 rpmB, - TP0362 cheY, - TP0366 cheX, - TP0365 cheA, - TP0363 TP0367 Type: tandem, Name:  - 248 TP0359 plsC, - TP0361 TP0358 TP0360 rpmB, - TP0362 cheY, - TP0366 cheX, - TP0365 cheA, - TP0363 TP0367 cheW,cheR, - TP0364 cheW,cheR, - TP0364
* Calculated from Protein Sequence

Gene ID: TP0363

DNA Molecule Name:
1  

Genbank ID:
3322640

Gene Name:
cheA  

Definition:
chemotaxis histidine kinase

Gene Start:
384578

Gene Stop:
387013

Gene Length:
2436

Molecular Weight*:
87687

pI*:
4.78

Net Charge*:
-30.33

EC:
2.7.3.-  

Functional Class:
Cellular processes; General  

Pathway: pathway table
Signal transduction; Bacterial chemotaxis

Primary Evidence:
Greene SR, Stamm LV. 1999. Molecular characterization of a chemotaxis operon in the oral spirochete, Treponema denticola. Gene May 17;232(1):59-68. Medline: 99267410.

Greene SR, Stamm LV, Hardham JM, Young NR, Frye JG. 1997. Identification, sequences, and expression of Treponema pallidum
chemotaxis genes. DNA Seq;7(5):267-84. Medline: 97399391.

Comment:
This protein is involved in the transmission of sensory signials from
the chemoreceptors to the flagellar motors. CheA is autophosphorylated
and it can transfer its phosphate group to either CheB or CheY.

See TP0364, CheW.
See TP0365, CheX.
See TP0366, CheY.
See TP0439, CheW.
See TP0630, CheR.
See TP0631, CheB.


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed that this protein is identical to histidine
kinase CheA of Treponema pallidum, (U61851). In addition there were
several other hits to chemotaxis histidine kinases. For example
residues 198-795 are 38% similar to CHEA_BORBU, chemotaxis histidine
kinase of Borrelia burgdorferi,(U28962).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0643
COG name: Chemotaxis protein histidine kinase and related kinases
Functional Class:  N
The phylogenetic pattern of COG0643 is a--k--vCeb--uj--Ol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 565-579, 605-615, 621-639, and 645-658 represent significant
(99%) hits to blocks (PR00344A,B,C,D), BACTERIAL SENSOR PROTEIN C-TERMINAL
SIGNATURE.

ProDom Summary:  Protein Domain Search
Residues 461-611 are 56% similar to chemotaxis histidine kinase of
CHEA_BORBU. Residues 11-132, 180-252, and 663-762 also strongly support
this match. Residues 8-176 are 27% similar to a GLIDING MOTILITY
REGULATORY PROTEIN of FRZE_MYXXA.

Paralogs:  Local Blast Search
This protein is weakly paralogous to TP0439, purine-binding
chemotaxis protein (cheW). Residues 665-761 are 25% similar to
TP0439.

Pfam Summary:  Pfam Search
Residues 11 to 115 (E-value = 4.6e-47) place TP0363 in the Hpt family which is described as Hpt domain (PF01627)
Residues 197 to 285 (E-value = 1.7e-30) place TP0363 in the P2 family which is described as P2 response regulator binding domain (PF07194)
Residues 350 to 475 (E-value = 6.3e-10) place TP0363 in the H-kinase_dim family which is described as Signal transducing histidine kinase, homodimeric domain (PF02895)
Residues 520 to 660 (E-value = 2.9e-31) place TP0363 in the HATPase_c family which is described as Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase (PF02518)
Residues 663 to 797 (E-value = 7.5e-40) place TP0363 in the CheW family which is described as CheW-like domain (PF01584)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
12  
39
non-globular  
51  
203
non-globular  
246  
382

PDB Hit:
None

Gene Protein Sequence:
MPMSDYLDAGNEELLKDFFSEAEQQVEQLESNILVIEQDPTNRDAVDEIF
RAAHTLKGGAATVEMHELSGFTHAVEDLLDGIRSEKVTVDGAVVDLLLTS
LDVIKAMLESRAGGGPYAEDVSDLVARLRSYLPASGTVPGAARGLSVSSP
NAAEAAKGTAVGEDGTEAPQVGRVPPLSLLSEYDRLELREIVPPEHSVYA
LTVRFDESNLMNTVGGIQVFTALKSCASVLKTVPDFDALYQDMFHEYVVY
FVSTVQDSVCVSQVASIPDVTLSVSVAEVALADLCTPLSEHGELGVCADA
GTGGVSEGSGAAVRSGGERVPNSLPKQVAGCAVPSAKDSSKATSSGYGSG
SVLRVDAKRIDYLLNLVSETVIIKASLNQSALEFGEVYTLFQNANGAYKE
RLRKFFDRVPAYLEKVKNGQDADAVRKGMIAEAVGVFDIFSSFENGLKQS
VTKFRSSAQNLGRISGELQEGVMKIRMVPISQIFSRYPRVVRDLSRDLRK
EVRLVIEGEETELDKSVVEDLLDPIMHCVRNSLDHGIEAPEVRARSGKPA
QGTLLLRASNEGNMIVIEVADDGRGIDVEAVKTKAVERGVLHPGKNLTEV
EAFQLIFAPGFSTSRSVSNVSGRGVGLDVVKTHIERLNGTVSVFSEVQKG
TRFVIKLPLTLAIIQGLLIRVGQEVYSIPIASVIESHRIKSEEINRIDNY
EVFNVRNEVISLLRLDRLFGISCDDEVTGQYHYVVIVGAAEKKVGLMVDA
LIGEEDVVIKPLRDQFTSSPGIAGASILGDGSVSLIIDVGQLLELGLKRE
ILARERREATVW

Gene Nucleotide Sequence:  Sequence Viewer
GTGCCCATGAGCGATTACCTCGACGCGGGCAACGAAGAGTTGCTGAAGGA
TTTTTTCAGCGAGGCGGAGCAACAGGTTGAGCAGCTCGAAAGCAATATAC
TCGTCATTGAGCAGGATCCCACCAATCGGGACGCTGTAGACGAGATTTTC
CGTGCGGCGCACACCCTTAAGGGGGGTGCTGCGACTGTTGAGATGCACGA
GTTGTCCGGCTTCACGCATGCGGTGGAGGATCTGCTGGATGGGATTCGCT
CAGAGAAGGTAACTGTTGACGGGGCGGTTGTGGACTTGCTCCTGACGTCG
TTGGATGTAATTAAGGCGATGCTCGAGTCCCGTGCGGGCGGTGGTCCCTA
CGCGGAGGATGTCTCGGATCTCGTTGCGCGTCTGCGCTCGTATCTGCCTG
CGTCTGGGACTGTGCCGGGGGCGGCGCGTGGATTGTCGGTGTCTTCGCCA
AATGCAGCCGAAGCTGCAAAGGGGACCGCGGTAGGTGAAGATGGGACGGA
AGCCCCTCAGGTAGGGCGAGTGCCGCCGCTGTCTCTTCTTTCTGAATACG
ATCGGTTGGAATTGCGCGAGATCGTTCCGCCTGAGCACTCTGTCTACGCG
CTTACGGTGCGTTTTGATGAGAGTAATCTGATGAACACGGTCGGCGGTAT
CCAGGTGTTTACAGCGTTGAAGTCCTGCGCAAGCGTGCTCAAGACGGTTC
CTGATTTCGACGCACTGTATCAGGACATGTTCCATGAGTATGTTGTGTAC
TTCGTTTCCACTGTGCAGGATTCAGTATGTGTGTCGCAGGTTGCTTCGAT
TCCGGACGTTACGCTTTCGGTGAGTGTAGCGGAAGTTGCGCTTGCAGATC
TGTGTACTCCCCTCTCTGAACATGGGGAGCTGGGTGTTTGCGCAGACGCG
GGGACAGGTGGTGTGTCCGAAGGGAGCGGCGCTGCCGTGCGCAGCGGAGG
GGAACGCGTTCCTAACTCCCTGCCGAAACAGGTTGCCGGGTGCGCGGTGC
CTTCTGCAAAGGACTCATCAAAGGCTACCTCAAGCGGCTACGGCTCGGGG
TCCGTGTTGCGCGTAGATGCGAAACGCATCGATTATCTTCTGAATTTGGT
AAGTGAGACGGTGATTATCAAGGCCTCGCTCAATCAGAGTGCGCTTGAAT
TTGGGGAGGTGTACACCCTATTCCAAAACGCTAATGGCGCGTACAAGGAG
CGTTTGCGTAAGTTTTTTGATAGGGTTCCCGCTTACTTAGAAAAGGTAAA
GAACGGTCAGGACGCAGATGCGGTGCGCAAGGGGATGATAGCAGAGGCTG
TCGGTGTCTTTGACATTTTTTCTTCGTTTGAGAATGGACTGAAACAGTCC
GTCACTAAGTTTCGGTCTTCTGCTCAGAATTTGGGGCGTATTTCTGGTGA
GCTTCAAGAAGGTGTGATGAAAATCCGCATGGTGCCTATTAGCCAGATTT
TCAGTCGTTATCCGCGTGTGGTGCGCGATCTCTCGCGGGACTTGCGTAAA
GAGGTGCGGTTGGTCATTGAAGGAGAGGAGACGGAGCTTGATAAGTCTGT
GGTTGAAGATTTGCTCGATCCCATTATGCACTGCGTGCGTAATTCTCTCG
ACCACGGCATAGAAGCGCCTGAAGTTCGCGCGCGCTCTGGAAAACCGGCG
CAAGGTACGCTTCTCCTGCGCGCAAGCAACGAAGGAAATATGATCGTTAT
TGAGGTTGCCGATGACGGGCGTGGCATCGACGTGGAGGCAGTGAAGACGA
AAGCAGTTGAGCGAGGTGTGTTGCACCCAGGCAAGAACCTCACTGAGGTT
GAGGCGTTCCAACTTATTTTTGCTCCCGGTTTTTCAACCTCTCGGTCGGT
TTCTAATGTTTCTGGTCGGGGTGTGGGGCTTGATGTGGTGAAGACTCACA
TTGAGAGGCTCAATGGCACTGTCTCCGTCTTTTCGGAAGTGCAGAAGGGA
ACGCGCTTTGTCATAAAGCTGCCGCTTACACTGGCAATTATTCAGGGGCT
CTTGATACGGGTGGGGCAGGAGGTGTACTCGATACCGATAGCTTCGGTCA
TCGAAAGCCATCGTATCAAGAGTGAAGAGATTAACCGGATTGATAACTAC
GAGGTGTTCAATGTGCGGAACGAGGTCATTAGCTTGCTGCGTCTCGATAG
GCTGTTCGGTATCAGCTGCGATGATGAGGTGACCGGTCAGTATCACTATG
TGGTTATAGTTGGTGCGGCAGAGAAAAAGGTGGGGCTCATGGTGGATGCG
CTGATTGGTGAGGAGGACGTAGTCATCAAGCCACTGCGGGATCAATTCAC
TAGTTCCCCTGGTATTGCAGGGGCATCTATCCTGGGTGACGGTTCGGTGT
CGTTGATTATCGATGTGGGGCAGCTGCTTGAGCTTGGGTTGAAGCGGGAA
ATATTGGCGCGTGAGCGTCGAGAAGCCACGGTGTGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy