Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR268 IGR265 IGR266 IGR269 IGR264 IGR263 IGR267 IGR270 TP0355 TP0359 plsC, - TP0361 TP0358 TP0360 rpmB, - TP0362 TP0356 tmk, - TP0354 birA, - TP0357 cheA, - TP0363 TP0355 TP0359 plsC, - TP0361 TP0358 TP0360 rpmB, - TP0362 TP0356 tmk, - TP0354 birA, - TP0357 cheA, - TP0363 TP0355 TP0359 plsC, - TP0361 TP0358 TP0360 rpmB, - TP0362 TP0356 tmk, - TP0354 birA, - TP0357 cheA, - TP0363 cheW,cheR, - TP0364 cheW,cheR, - TP0364
* Calculated from Protein Sequence

Gene ID: TP0361

DNA Molecule Name:
1  

Genbank ID:
3322638

Gene Name:
plsC  

Definition:
1-acyl-sn-glycerol-3-phosphate acyltransferase

Gene Start:
383774

Gene Stop:
382929

Gene Length:
846

Molecular Weight*:
31686

pI*:
10.75

Net Charge*:
20.25

EC:
2.3.1.51  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Metabolism of complex lipids; Glycerolipid metabolism

Comment:
This reaction is the second step in de novo phospholipid biosynthesis.

Reaction:
ACYL-COA + 1-ACYL-SN-GLYCEROL 3-PHOSPHATE =
COA + 1,2-DIACYL-SN-GLYCEROL 3-PHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to 1-acyl-sn-glycerol-3-
phosphate acyltransferases. For example residues 89-266 are 30% similar
to PLSC_MYCGE, 1-acyl-sn-glycerol-3-phosphate acetyltransferase
homolog of Mycoplasma genitalium (SGC3),(U39698).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0204
COG name: 1-acyl-sn-glycerol-3-phosphate acyltransferase
Functional Class:  I
The phylogenetic pattern of COG0204 is ----YQvCEbRhujgpolINX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 89-256 are 31% similar to 1-acyl-sn-glycerol-3-phosphate
acyltransferase of PLSC_MYCGE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 75 to 208 (E-value = 3.3e-15) place TP0361 in the Acyltransferase family which is described as Acyltransferase (PF01553)

Structural Feature(s):
Feature Type  Start  Stop
gram positive/gram negative signal  
1  
35

PDB Hit:
none

Gene Protein Sequence:
MLPCAVVNQRRRSALMCGILSIVVSIAVLAPLAVANTLCYALYRPGCRWV
NHAVSTWGARTIFAVLHTYGRLKFYSDYTHAEHLPTQYLVVSNHQSVLDT
PALMRYFGYIDAPRLRFVAKRELARFVPLVSTMLKSGRHCLVDRHQSGAQ
AMQALETFTHHVMRERWLPVIFPEGTRSRNGALRIFHAAGFRALTARLPL
PVVVCALDGGWNLRPLLKIGQKLKGSAYRVKVLGVYPAPHNKDEQLSLLR
EAKALIQAQLDVWRSETTCPQDECLTRASKDS

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCCCCTGTGCGGTGGTCAACCAACGCAGAAGGAGCGCCCTCATGTG
CGGAATTCTCTCCATCGTCGTAAGTATCGCTGTTCTTGCACCGCTGGCAG
TTGCAAACACCCTCTGCTACGCACTGTACCGCCCGGGATGCAGATGGGTT
AATCACGCGGTATCCACCTGGGGTGCACGGACTATCTTTGCCGTTCTACA
TACCTACGGAAGACTTAAGTTTTACAGCGACTACACCCACGCTGAGCACC
TGCCCACGCAGTACCTTGTAGTCTCAAATCATCAAAGTGTGCTAGACACC
CCTGCACTCATGCGTTACTTTGGCTATATTGATGCGCCGAGGTTGCGCTT
CGTAGCAAAGCGAGAGCTCGCGCGCTTCGTCCCCCTTGTGTCCACCATGC
TCAAAAGCGGTCGGCACTGCCTGGTAGACCGGCATCAGTCAGGAGCACAG
GCGATGCAAGCGCTCGAAACGTTTACACACCACGTCATGCGAGAGCGATG
GCTCCCTGTGATCTTCCCTGAAGGGACACGATCAAGAAACGGCGCCCTGC
GCATCTTCCACGCCGCAGGCTTCCGTGCGCTCACGGCACGGCTCCCACTC
CCCGTAGTTGTATGCGCGTTGGACGGAGGGTGGAACCTACGCCCGTTGCT
GAAAATAGGACAGAAGCTTAAAGGAAGCGCTTACCGCGTCAAAGTGCTCG
GCGTTTACCCCGCACCCCACAACAAAGACGAACAGCTCTCCCTCCTACGC
GAGGCAAAAGCGCTCATTCAAGCGCAGCTAGACGTCTGGCGCTCGGAGAC
CACCTGTCCTCAAGACGAGTGCCTCACGCGCGCCTCCAAAGACTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy