Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR268 IGR261 IGR265 IGR266 IGR269 IGR264 IGR260 IGR263 IGR267 IGR262 IGR270 TP0355 rnh, - TP0353 TP0359 plsC, - TP0361 TP0358 TP0360 rpmB, - TP0362 TP0352 TP0356 tmk, - TP0354 birA, - TP0357 proB, - TP0351 gpr,proA, - TP0350 cheA, - TP0363 TP0355 rnh, - TP0353 TP0359 plsC, - TP0361 TP0358 TP0360 rpmB, - TP0362 TP0352 TP0356 tmk, - TP0354 birA, - TP0357 proB, - TP0351 gpr,proA, - TP0350 cheA, - TP0363 Type: tandem, Name:  - 84 Type: tandem, Name:  - 85 Type: tandem, Name:  - 247 TP0355 rnh, - TP0353 TP0359 plsC, - TP0361 TP0358 TP0360 rpmB, - TP0362 TP0352 TP0356 tmk, - TP0354 birA, - TP0357 proB, - TP0351 gpr,proA, - TP0350 cheA, - TP0363
* Calculated from Protein Sequence

Gene ID: TP0357

DNA Molecule Name:
1  

Genbank ID:
3322635

Gene Name:
birA  

Definition:
biotin--acetyl-CoA-carboxylase ligase

Gene Start:
379570

Gene Stop:
380307

Gene Length:
738

Molecular Weight*:
26193

pI*:
7.77

Net Charge*:
3.43

EC:
6.3.4.15  

Functional Class:
Regulatory functions  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This protein activates biotin to form biotinyl-5'-adenylate and transfers
the biotin moiety to biotin-accepting proteins.

Reaction:
ATP + BIOTIN + APO-[ACETYL-COA:CARBON-DIOXIDE LIGASE (ADP FORMING)] =
AMP + PYROPHOSPHATE + [ACETYL-COA:CARBON-DIOXIDE LIGASE (ADP FORMING)]

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to biotin--acetyl-CoA-
carboxylase ligases. For example residues 23-174 are 35% similar to
BIRA_PARDE biotin [acetyl-CoA carboxylase] ligase of Paracoccus
denitrificans,(L02354).

COGS Summary:  COGS Search
BeTs to 14 clades of COG0340
COG name: Biotin-(acetyl-CoA carboxylase) ligase
Functional Class:  H
The phylogenetic pattern of COG0340 is amtkyqvcebrhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 23-140 are 40% similar to biotin--acetyl-CoA-carboxylase
synthetase of BIRA_PARDE.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 20 to 146 (E-value = 1.4e-35) place TP0357 in the BPL_LipA_LipB family which is described as Biotin/lipoate A/B protein ligase family (PF03099)
Residues 202 to 246 (E-value = 4.8e-10) place TP0357 in the BPL_C family which is described as Biotin protein ligase C terminal domain (PF02237)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
73  
103
transmembrane  
123  
141
transmembrane  
171  
190

PDB Hit:
gi|442676|pdb|1BIA| Bira Bifunctional Protein (Acts As Biotin Operon Repressor And Biotin Holoenzyme Synthetase) (E.C.6.3.4.15)

Gene Protein Sequence:
MCVAVCLVPVRNPFGASVYFAPKTASTMDEAASRAQGCEEGAVFCAGEQV
AGRGRGDQRKWQSEPGKNLLCTVVLRRVAFPAFSLCVGYAVALAYMAFLG
GVCAPRIKWPNDVLVCDRKIAGVLCQVRAGALLVGIGCNLLQVKFPPELS
HACSLAQIVGGERCPDPFAFLPVLLDRLYACVMAPPSIGVLESCLWKQGE
YVCFRECAGTRPPILGRVVGLAADGALCIDSAGSMRSYYSGEIAFW

Gene Nucleotide Sequence:  Sequence Viewer
GTGTGCGTCGCGGTGTGTTTGGTTCCTGTTAGGAACCCCTTCGGGGCTTC
TGTCTATTTTGCTCCCAAGACTGCTAGTACTATGGATGAGGCTGCGTCTC
GCGCCCAGGGTTGCGAGGAGGGTGCCGTCTTTTGCGCTGGTGAGCAGGTT
GCTGGACGTGGTCGTGGTGACCAGAGAAAGTGGCAATCGGAGCCGGGAAA
GAATCTTTTGTGTACTGTCGTTTTGCGGCGTGTTGCTTTCCCTGCGTTTT
CGCTCTGTGTTGGATATGCGGTCGCTCTTGCATACATGGCCTTCCTCGGA
GGTGTGTGCGCACCGCGCATTAAGTGGCCCAACGACGTCCTGGTGTGCGA
TCGTAAGATCGCCGGGGTGCTCTGCCAGGTGCGCGCGGGAGCGCTTCTCG
TGGGTATTGGGTGTAACCTCCTGCAGGTGAAGTTTCCGCCCGAGTTGTCG
CATGCCTGCTCTCTCGCGCAGATTGTCGGAGGCGAGCGGTGCCCTGATCC
GTTTGCTTTCCTTCCTGTGCTGTTGGATCGGCTGTATGCCTGTGTCATGG
CGCCGCCGAGTATCGGCGTGCTTGAGTCGTGTCTGTGGAAGCAGGGTGAG
TACGTCTGTTTCCGCGAATGTGCGGGAACACGTCCTCCGATTCTGGGTCG
TGTTGTCGGATTGGCCGCGGACGGCGCGCTGTGCATAGATAGCGCTGGGT
CGATGCGATCGTATTACTCTGGGGAGATCGCCTTTTGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy