Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR261 IGR265 IGR266 IGR264 IGR260 IGR263 IGR259 IGR262 TP0355 rnh, - TP0353 TP0359 TP0348 TP0358 TP0352 TP0356 tmk, - TP0354 birA, - TP0357 TP0347 proB, - TP0351 gpr,proA, - TP0350 TP0355 rnh, - TP0353 TP0359 TP0348 TP0358 TP0352 TP0356 tmk, - TP0354 birA, - TP0357 TP0347 proB, - TP0351 gpr,proA, - TP0350 Type: tandem, Name:  - 85 Type: tandem, Name:  - 82 Type: tandem, Name:  - 83 Type: tandem, Name:  - 84 Type: tandem, Name:  - 247 TP0355 rnh, - TP0353 TP0359 TP0348 TP0358 slyD, - TP0349 slyD, - TP0349 TP0352 TP0356 tmk, - TP0354 birA, - TP0357 TP0347 proB, - TP0351 gpr,proA, - TP0350
* Calculated from Protein Sequence

Gene ID: TP0353

DNA Molecule Name:
1  

Genbank ID:
3322632

Gene Name:
rnh  

Definition:
ribonuclease H

Gene Start:
377707

Gene Stop:
377201

Gene Length:
507

Molecular Weight*:
18058

pI*:
6.66

Net Charge*:
-1.00

EC:
3.1.26.4  

Functional Class:
Transcription; Degradation of RNA  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This enzyme is an endonuclease that degrades the RNA of RNA-DNA hybrids
specifically. In E. coli RNase H participates in DNA replication; it
helps to specify the origin of genomic replication by suppressing
initiation at origins other than the locus OriC; along with the 5'-3'
exonuclease of Pol1, it removes RNA primers from the Okazaki fragments
of lagging strand synthesis; and it defined the origin of replication
for ColE1-type plasmids by specific cleavage of an RNA preprimer. It
also requires magnesium for activity.

Reaction:
ENDONUCLEOLYTIC CLEAVAGE TO 5'-PHOSPHO-MONOESTER.

There are many examples of 3D structures for this protein.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to ribonuclease H.
For example residues 9-150 are 50% similar to RNH_ECOLI, ribonuclease
H of Escherichia coli, (U70214).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0328
COG name: Ribonuclease HI
Functional Class:  L
The phylogenetic pattern of COG0328 is ----y--cebrhuj---l--x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 86-124 are 76% similar to ribonuclease H of RNH_ECOLI. Residues
9-72 and 133-150 also support this match. Residues 58-133 are 31%
similar to REVERSE TRANSCRIPTASE of POL_FOAMV, however the score is
low.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 4 to 159 (E-value = 4.8e-56) place TP0353 in the RnaseH family which is described as RNase H (PF00075)

PDB Hit:
gi|494541|pdb|1RBS| Ribonuclease H (E.C.3.1.26.4) Mutant With His 62 Replaced By Ala (H62a)

Gene Protein Sequence:
MNAHAALTLYTDGACLGNPGPGGWAFALVPSDVPFLETGQXAPEAAAFTR
SGSAYPSTNNRMELCAVINALQEAHGRAAEAVVVVTDSQYVRKGITQWIH
TWKHNGWKTAAKQPVKNKDLWEALSALADALSVEWRWVKGHAGDPYNELC
DRLATDAARRAAQSTADCP

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACGCGCACGCTGCACTTACCCTGTACACTGACGGCGCCTGTCTGGG
AAACCCGGGTCCGGGCGGGTGGGCGTTTGCTCTGGTGCCCTCAGACGTAC
CCTTTCTAGAAACCGGACAAANNGCACCAGAAGCTGCCGCATTCACTAGA
AGCGGCAGCGCCTACCCGAGCACAAACAATCGCATGGAACTGTGCGCGGT
CATCAACGCACTGCAAGAGGCACACGGACGCGCTGCAGAGGCGGTGGTAG
TGGTCACCGACTCCCAATACGTACGCAAAGGCATCACCCAGTGGATCCAT
ACCTGGAAACACAACGGCTGGAAAACGGCTGCCAAACAACCGGTCAAGAA
CAAGGATTTGTGGGAAGCGCTCAGCGCACTCGCCGACGCCCTATCCGTCG
AGTGGCGCTGGGTAAAAGGACATGCAGGAGACCCGTACAACGAACTGTGC
GACCGGCTAGCCACCGACGCTGCGCGCCGCGCTGCACAAAGCACTGCAGA
CTGTCCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy