Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR261 IGR260 IGR257 IGR258 IGR263 IGR259 IGR262 TP0355 rnh, - TP0353 TP0348 trcF, - TP0344 TP0352 TP0356 tmk, - TP0354 TP0347 proB, - TP0351 mraY, - TP0345 gpr,proA, - TP0350 TP0355 rnh, - TP0353 TP0348 trcF, - TP0344 TP0352 TP0356 tmk, - TP0354 TP0347 proB, - TP0351 mraY, - TP0345 gpr,proA, - TP0350 Type: tandem, Name:  - 83 Type: tandem, Name:  - 80 Type: tandem, Name:  - 85 Type: tandem, Name:  - 81 Type: tandem, Name:  - 82 Type: tandem, Name:  - 84 Type: tandem, Name:  - 247 TP0355 rnh, - TP0353 TP0348 trcF, - TP0344 slyD, - TP0349 slyD, - TP0349 TP0352 tmk, - TP0354 TP0347 proB, - TP0351 mraY, - TP0345 gpr,proA, - TP0350 TP0346 TP0346
* Calculated from Protein Sequence

Gene ID: TP0349

DNA Molecule Name:
1  

Genbank ID:
3322625

Gene Name:
slyD  

Definition:
peptidyl-prolyl cis-trans isomerase, FKBP-type

Gene Start:
374425

Gene Stop:
373898

Gene Length:
528

Molecular Weight*:
18413

pI*:
4.14

Net Charge*:
-17.27

EC:
5.2.1.8  

Functional Class:
Translation; Protein modification  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
Peptidyl-prolyl isomerases accelerate the folding of proteins.

Reaction:
Cis-trans isomerization of proline imidic peptide bonds in oligopeptides.

See Shevchenko et al., Infect Immun 1997 Oct;65(10):4179-89. How
does this protein relate to what they call ppiB?


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to peptidyl-prolyl
cis-trans isomerase, FKBP-type proteins. For example residues 1-148
are 42% similar to SLYD_ECOLI, FKBP-type peptidyl-prolyl cis-trans
isomerase of E. coli, (Z21496).

COGS Summary:  COGS Search
BeTs to 7 clades of COG1047
COG name: FKBP-type peptidyl-prolyl cis-trans isomerases 2
Functional Class:  O
The phylogenetic pattern of COG1047 is aMtk----E--huj---l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 12-26, 36-69, and 124-136 represent significant (99%) hits to
blocks (BL00453A,B,C), FKBP-type peptidyl-prolyl cis-trans isomerase
proteins.

ProDom Summary:  Protein Domain Search
Residues 9-82 are 40% similar to peptidyl-prolyl cis-trans isomerase,
FKBP-type of SLYD_ECOLI. Residues 90-136 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum. See, however,
TP0506.

Pfam Summary:  Pfam Search
Residues 2 to 137 (E-value = 2.3e-05) place TP0349 in the FKBP_C family which is described as FKBP-type peptidyl-prolyl cis-trans isomerase (PF00254)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
157  
176

PDB Hit:
none

Gene Protein Sequence:
MKIANECVVNIEYTLRDDTGEIIDSSDVMGALEYVQGHGMIIPGLETALI
NREEGEEFSVTIPPVGAYGEVQEDLRMTVGRDQFPPNVPIEVGMRFDAGS
GGDSRPVTVTDVQGETIIVDGNHPLAGKTLHFEVAVRSVREATDDDLAAL
LFRESTSGGGCGSGAGGCGSCGAGCH

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATCGCAAATGAGTGTGTGGTGAACATCGAGTACACCCTGCGAGA
TGACACGGGGGAGATCATCGATTCTTCCGACGTGATGGGTGCGCTCGAGT
ATGTTCAGGGGCACGGCATGATCATTCCTGGCCTCGAGACCGCCTTAATT
AACCGAGAAGAGGGGGAGGAGTTTTCAGTAACCATTCCTCCGGTAGGAGC
GTATGGAGAGGTGCAGGAGGACTTGCGCATGACAGTGGGGCGAGATCAGT
TTCCTCCAAACGTGCCAATAGAGGTGGGCATGCGGTTTGATGCAGGAAGC
GGGGGTGACAGTCGACCGGTGACCGTCACTGACGTGCAAGGTGAAACGAT
TATTGTAGATGGAAATCATCCCCTCGCGGGGAAGACGCTCCACTTTGAGG
TGGCTGTGCGCTCTGTGCGAGAGGCGACGGACGATGACTTAGCTGCACTT
CTGTTTCGGGAAAGCACCAGCGGCGGTGGCTGTGGGAGCGGCGCGGGAGG
GTGCGGCTCGTGCGGAGCAGGCTGCCAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy