Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR256 IGR254 IGR255 IGR257 folC, - TP0340 trcF, - TP0344 mutY, - TP0343 TP0339 mraY, - TP0345 murC, - TP0341 folC, - TP0340 trcF, - TP0344 mutY, - TP0343 TP0339 mraY, - TP0345 murC, - TP0341 Type: tandem, Name:  - 292 Type: tandem, Name:  - 79 Type: tandem, Name:  - 80 Type: tandem, Name:  - 246 folC, - TP0340 trcF, - TP0344 mutY, - TP0343 TP0339 mraY, - TP0345 murC, - TP0341 cmk, - TP0342 cmk, - TP0342
* Calculated from Protein Sequence

Gene ID: TP0343

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mutY  

Definition:
A/G-specific adenine glycosylase

Gene Start:
365621

Gene Stop:
366451

Gene Length:
831

Molecular Weight*:
31705

pI*:
8.98

Net Charge*:
7.41

EC:
3.2.2.-  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This adenine glycosylase has activity on G-A and C-A mispairs. It
requires a 4Fe-4S cluster which is not important for the catalytic
activity, but which is probably involved in the proper positioning of
the enzyme along the DNA strand.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to A/G-specific adenine
glycosylases. For example residues 10-195 are 34% similar to A/G-
specific adenine glycosylase of Bacillus subtilis,(Z99108).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1194
COG name: A/G-specific DNA glycosylase
Functional Class:  L
The phylogenetic pattern of COG1194 is --t-----ebrhuj---lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 96-150 represent significant (99%) hits to blocks (BL00764B),
Endonuclease III iron-sulfur binding region proteins. Residues 182-192
represent significant (98%) hits to blocks (BL00259), Gastrin /
cholecystokinin family proteins. Residues 184-211 represent significant
(95%) hits to blocks (BL00247C), HBGF/FGF family proteins.

ProDom Summary:  Protein Domain Search
Residues 38-195 are 35% similar to A/G-specific adenine glycosylase
of MUTY_ECOLI.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0775 endonuclease III.
Residues 89-148 are 35% similar to TP0775.

Pfam Summary:  Pfam Search
Residues 42 to 174 (E-value = 1.8e-21) place TP0343 in the HhH-GPD family which is described as HhH-GPD superfamily base excision DNA repair protein (PF00730)
Residues 106 to 135 (E-value = 4e-06) place TP0343 in the HHH family which is described as Helix-hairpin-helix motif (PF00633)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
129  
153

PDB Hit:
none

Gene Protein Sequence:
MVGLSQSAGDIEKFQNAILDFYAQQGRDFPWRSTCDAYAILVSEFMLQQT
QTERVCPKYAEWLHRFPSLESLACAPFAHVLQAWIGLGYNRRARFLHQSA
KLIVERYCAVVPDDPSELKKLPGVGDYTAAAVACFAYNKATVFLETNIRA
VFIRFFFPDTHQVSDRELLSLVRCTLYEENPRRWYYALMDYGAVLKRKIT
NPNRRSKHYVKQSPFEGSLRQVRGAVLREISGMQHAVREKTLFAKLSFEH
ERLSRALDSLVSEGLVVKTEAGYSIAD

Gene Nucleotide Sequence:  Sequence Viewer
TTGGTAGGGCTGAGCCAATCTGCGGGTGATATAGAAAAGTTTCAAAACGC
CATATTGGATTTTTATGCACAGCAGGGCAGGGATTTTCCGTGGAGAAGTA
CTTGCGACGCGTATGCGATACTGGTGTCTGAGTTTATGTTACAACAGACA
CAGACGGAGCGGGTGTGTCCGAAGTATGCAGAATGGCTTCATCGTTTTCC
TTCTTTGGAGTCTCTTGCGTGCGCTCCATTTGCGCACGTGCTCCAAGCGT
GGATTGGATTAGGATACAACAGGCGCGCTCGTTTTTTGCATCAGTCGGCA
AAACTCATTGTTGAAAGGTATTGTGCAGTAGTTCCTGATGACCCGAGTGA
ACTAAAGAAGCTCCCCGGTGTCGGTGACTATACTGCCGCTGCAGTTGCTT
GCTTTGCGTACAATAAGGCCACCGTGTTTTTAGAAACAAACATCCGTGCA
GTGTTTATACGCTTTTTCTTTCCCGATACGCACCAGGTCAGTGATCGGGA
GTTGCTCTCGCTGGTCCGGTGCACCCTGTATGAGGAAAATCCTCGGCGTT
GGTACTACGCACTGATGGATTATGGGGCAGTTCTAAAAAGGAAGATTACA
AATCCTAATCGTCGCAGCAAGCATTACGTGAAGCAGTCACCGTTTGAAGG
TTCTCTGAGGCAGGTGCGTGGAGCGGTTTTAAGAGAGATAAGCGGCATGC
AACACGCGGTGCGCGAGAAAACGCTTTTCGCAAAGCTGTCCTTTGAGCAC
GAAAGATTGAGCCGCGCTCTAGACTCGCTGGTAAGCGAGGGACTGGTAGT
AAAAACAGAGGCTGGGTATTCCATCGCTGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy