Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR256 IGR253 IGR254 IGR252 IGR255 IGR257 folC, - TP0340 trcF, - TP0344 TP0338 mutY, - TP0343 ksgA, - TP0337 TP0339 mraY, - TP0345 murC, - TP0341 folC, - TP0340 trcF, - TP0344 TP0338 mutY, - TP0343 ksgA, - TP0337 TP0339 mraY, - TP0345 murC, - TP0341 Type: tandem, Name:  - 79 Type: tandem, Name:  - 246 Type: tandem, Name:  - 292 folC, - TP0340 trcF, - TP0344 mutY, - TP0343 ksgA, - TP0337 TP0339 mraY, - TP0345 murC, - TP0341 cmk, - TP0342 cmk, - TP0342 TP0338
* Calculated from Protein Sequence

Gene ID: TP0342

DNA Molecule Name:
1  

Genbank ID:
3322621

Gene Name:
cmk  

Definition:
cytidylate kinase

Gene Start:
365067

Gene Stop:
365624

Gene Length:
558

Molecular Weight*:
20720

pI*:
8.62

Net Charge*:
4.00

EC:
2.7.4.14  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  

Pathway: pathway table
Nucleotide metabolism; Pyrimidine Metabolism

Comment:
Reaction:
ATP + CMP = ADP + CDP

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to cytidylate kinases.
For example residues 13-184 are 42% similar to cytidylate kinase of
Borrelia burgdorferi,(AE001180).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1102
COG name: Cytidylate kinase 2
Functional Class:  F
The phylogenetic pattern of COG1102 is amtk------------ol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 63-128 are 33% similar to Y656_METJA, a hypothetical protein
with similarity to adenylate kinases, however the E value for this hit
is quite low.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MSNRCDVSGNKAVRIAVSGASGCGNTTVSALLAERLGLPLVNYTFRNIAR
ELGISLSEVLERARTDNHFDKAVDARQLCLAMRSSCVVGSRLAIWLVKDA
ALKVYLLASLKERVKRVLQREGGDVQDVERFTSMRDAEDMSRYKKLYRID
NTNYSFADLVLNTEGCDQETVVSIIIEMLRARGIAW

Gene Nucleotide Sequence:  Sequence Viewer
GTGAGTAATCGGTGCGATGTGTCTGGAAATAAGGCGGTACGCATAGCAGT
TTCAGGCGCGTCAGGGTGTGGTAATACCACCGTGTCTGCATTGCTTGCGG
AAAGACTGGGACTTCCCCTAGTGAATTATACGTTTAGGAATATTGCCCGG
GAGTTGGGTATCTCTCTTAGTGAGGTGCTCGAGCGTGCGCGGACGGATAA
TCATTTTGATAAAGCAGTTGATGCGCGGCAGCTCTGTCTTGCGATGCGTT
CTTCCTGCGTGGTAGGGTCGCGCCTGGCCATTTGGTTGGTGAAAGATGCC
GCGCTGAAGGTATATCTTTTGGCTTCATTAAAAGAGCGGGTGAAACGTGT
TCTCCAAAGGGAGGGAGGGGACGTACAGGATGTTGAGCGATTCACGTCTA
TGCGTGACGCTGAAGATATGAGTCGCTACAAAAAGTTGTATCGTATTGAT
AACACGAATTACAGTTTTGCAGATCTTGTTCTAAACACAGAAGGGTGCGA
TCAAGAAACAGTGGTGAGTATTATTATTGAAATGTTACGCGCTAGAGGGA
TAGCTTGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy