Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR256 IGR253 IGR254 IGR252 IGR255 folC, - TP0340 trcF, - TP0344 TP0338 mutY, - TP0343 TP0339 murC, - TP0341 comE, - TP0336 folC, - TP0340 trcF, - TP0344 TP0338 mutY, - TP0343 TP0339 murC, - TP0341 comE, - TP0336 Type: tandem, Name:  - 79 Type: tandem, Name:  - 246 Type: tandem, Name:  - 292 folC, - TP0340 trcF, - TP0344 mutY, - TP0343 TP0339 murC, - TP0341 comE, - TP0336 cmk, - TP0342 ksgA, - TP0337 cmk, - TP0342 ksgA, - TP0337 TP0338
* Calculated from Protein Sequence

Gene ID: TP0341

DNA Molecule Name:
1  

Genbank ID:
3322616

Gene Name:
murC  

Definition:
UDP-N-acetylmuramate--alanine ligase

Gene Start:
363501

Gene Stop:
364943

Gene Length:
1443

Molecular Weight*:
53751

pI*:
6.33

Net Charge*:
-7.06

EC:
6.3.2.8  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Metabolism of complex carbohydrates; Peptideglycan biosynthesis

Comment:
This protein is involved in cell wall formation, specifically
peptidoglycan biosynthesis.

Reaction:
ATP + UDP-N-ACETYLMURAMOYL + L-ALANINE =
ADP + ORTHOPHOSPHATE + UDP-N-ACETYLMURAMOYL-L-ALANINE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to UDP-N-acetylmuramate-
-alanine ligases. For example residues 15-473 are 37% similar to
UDP-N-acetylmuramate--alanine ligase (murC) of Borrelia burgdorferi,
(AE001180).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0773
COG name: UDP-N-acetylmuramate-alanine ligase
Functional Class:  M
The phylogenetic pattern of COG0773 is -----qvcEbrHuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 382-393 represent significant (99%) hits to blocks (PR00456B),
T.CRUZI P2 PROTEIN SIGNATURE. Residues 56-65 and 261-313 represent
significant hits to blocks (BL00665A,B), Dihydrodipicolinate synthetase
proteins.

ProDom Summary:  Protein Domain Search
Residues 115-236 are 35% similar to UDP-N-acetylmuramate--alanine
ligase of MURC_ECOLI. Residues 14-110, 84-205, 286-340 and 370-413
also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 49 to 319 (E-value = 3.3e-65) place TP0341 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 331 to 421 (E-value = 6.8e-30) place TP0341 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

PDB Hit:
none

Gene Protein Sequence:
MKRGTLPKDVSGIKIHMIGIKGTGMSALAELLCARGARVSGSDVADVFYT
DRILARLGVPVRTPFSCQNLADAPDVVIHSAAYVPEENDELAEAYRRGIP
TLTYPEALGDISCARFSCGIAGVHGKTTTTAMIAQMVKELRLDASVLVGS
AVSGNNDSCVVLNGDTFFIAETCEYRRHFLHFHPQKIVLTSVEHDHQDYY
SSYEDILAAYFHYIDRLPQFGELFYCVDDQGVREVVQLAFFSRPDLVYVP
YGERAWGDYGVSIHGVQDRKISFSLRGFAGEFYVALPGEHSVLNATGALA
LALSLVKKQYGEVTVEHLTALRKVLALFQGCRRRSEVLGEVRGILFMDDY
GHHPTAIKKTLRGLKTFFPERRIVVDFMSHTYSRTAALLTEFAESFQDAD
VVILHEIYASAREVYQGEVNGEHLFELTKRKHRRVYYYEAVMQAVPFLQA
ELKEGDLFVTLGAGDNCKLGEVLFNYFKEEV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGCGGGGGACTCTACCAAAAGATGTGTCAGGTATCAAGATTCACAT
GATTGGTATCAAGGGCACTGGCATGTCTGCGCTTGCAGAGCTACTGTGTG
CACGGGGTGCCCGTGTGTCAGGTAGTGATGTTGCAGATGTGTTTTACACG
GATAGGATTCTCGCCCGTTTGGGTGTTCCCGTGCGTACTCCCTTTTCTTG
CCAGAACCTTGCTGACGCTCCCGATGTGGTTATCCACTCTGCAGCCTATG
TGCCTGAAGAAAACGACGAGTTGGCAGAGGCGTACCGGCGGGGTATTCCT
ACCCTTACCTACCCAGAAGCGCTGGGGGACATTTCCTGTGCGCGGTTTTC
GTGTGGTATTGCAGGTGTTCATGGAAAGACGACCACGACCGCGATGATTG
CTCAAATGGTAAAGGAGCTGCGCCTTGATGCGTCCGTCCTTGTGGGGAGC
GCTGTTTCGGGAAACAATGATTCTTGTGTGGTTCTTAACGGAGATACCTT
TTTTATCGCAGAAACGTGCGAGTACCGTCGGCATTTCCTGCATTTTCATC
CTCAAAAGATTGTCCTCACCAGTGTTGAGCACGATCACCAGGATTATTAC
TCCTCGTACGAGGATATACTCGCGGCATACTTTCATTACATAGATAGGCT
TCCTCAATTTGGTGAGTTATTTTATTGCGTGGATGACCAGGGCGTGCGGG
AGGTAGTGCAGCTTGCGTTTTTCAGTAGACCGGACCTGGTGTATGTTCCT
TATGGGGAACGTGCGTGGGGCGATTATGGGGTCAGTATTCACGGTGTTCA
AGACCGGAAGATAAGCTTCTCATTGCGGGGTTTTGCAGGTGAGTTTTATG
TTGCGCTCCCCGGTGAGCATAGTGTTTTGAATGCAACCGGTGCGCTCGCA
TTAGCACTGAGTTTAGTGAAGAAGCAGTATGGAGAGGTTACCGTTGAGCA
CCTCACCGCTCTGCGGAAGGTACTCGCTCTTTTTCAGGGATGCCGGCGAA
GGAGTGAAGTTCTTGGGGAAGTGCGCGGTATTTTGTTCATGGACGATTAT
GGACATCATCCGACTGCAATTAAAAAGACGCTCCGCGGGTTAAAAACGTT
CTTTCCGGAAAGAAGAATTGTCGTCGATTTTATGTCCCATACATATTCGC
GTACCGCAGCCCTCCTCACCGAATTTGCTGAGTCTTTTCAGGATGCGGAT
GTAGTTATTTTGCATGAGATTTACGCCTCTGCTCGGGAAGTGTATCAGGG
CGAGGTGAACGGTGAACATCTTTTTGAATTAACTAAACGGAAGCACCGGC
GGGTGTATTATTACGAGGCTGTCATGCAGGCAGTGCCTTTTTTGCAGGCT
GAATTGAAAGAGGGCGACCTGTTCGTTACGCTCGGCGCTGGAGACAATTG
CAAATTGGGTGAGGTGTTGTTCAATTATTTTAAAGAGGAGGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy