Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR251 IGR253 IGR248 IGR254 IGR252 IGR250 IGR249 IGR255 TP0335 gnd, - TP0331 folC, - TP0340 TP0332 TP0338 cmk, - TP0342 TP0333 TP0339 TP0334 murC, - TP0341 comE, - TP0336 TP0335 gnd, - TP0331 folC, - TP0340 TP0332 TP0338 cmk, - TP0342 TP0333 TP0339 TP0334 murC, - TP0341 comE, - TP0336 Type: tandem, Name:  - 79 Type: tandem, Name:  - 245 Type: tandem, Name:  - 246 TP0335 gnd, - TP0331 folC, - TP0340 TP0333 TP0339 TP0334 murC, - TP0341 comE, - TP0336 ksgA, - TP0337 ksgA, - TP0337 TP0338 TP0332
* Calculated from Protein Sequence

Gene ID: TP0337

DNA Molecule Name:
1  

Genbank ID:
3322613

Gene Name:
ksgA  

Definition:
dimethyladenosine transferase

Gene Start:
359654

Gene Stop:
360508

Gene Length:
855

Molecular Weight*:
32262

pI*:
10.30

Net Charge*:
13.82

EC:
2.1.1.-  

Functional Class:
Translation; General  

Pathway: pathway table
Metabolism of cofactors, vitamins, and other substances; Ubiquinone biosynthesis

Secondary Evidence:
Chen J, Acton TB, Basu SK, Montelione GT, Inouye M.
Enhancement of the solubility of proteins overexpressed in Escherichia coli by heat shock.
J Mol Microbiol Biotechnol. 2002 Nov;4(6):519-24.
PMID: 12432951

Lu Q, Inouye M.
The gene for 16S rRNA methyltransferase (ksgA) functions as a multicopy suppressor for a cold-sensitive mutant of era, an essential RAS-like GTP-binding protein in Escherichia coli.
J Bacteriol. 1998 Oct;180(19):5243-6.
PMID: 9748462

Formenoy LJ, Cunningham PR, Nurse K, Pleij CW, Ofengand J.
Methylation of the conserved A1518-A1519 in Escherichia coli 16S ribosomal RNA by the ksgA methyltransferase is influenced by methylations around the similarly conserved U1512.G1523 base pair in the 3' terminal hairpin.
Biochimie. 1994;76(12):1123-8.
PMID: 7538324

Comment:
This protein specifically dimethylates two adjacent adenosines in the
loop of a conserved hairpin near the 3'-end of 16S rRNA in the 30S
particle. Its inactivation leads to kasgamycin resistance.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to dimethyladenosine
transferases. For example residues 14-281 are 32% similar to KSGA_BACSU,
dimethyladenosine transferase of Bacillus subtilis,(D26185).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0030
COG name: Dimethyladenosine transferase (rRNA methylation)
Functional Class:? J
The phylogenetic pattern of COG0030 is amtkyqvcebRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 38-83, 118-131, and 184-205 represent significant (99%) hits
to blocks BL01131A,B,C, Ribosomal RNA adenine dimethylases proteins.

ProDom Summary:  Protein Domain Search
Residues 142-206 are 35% similar to DIMETHYLADENOSINE TRANSFERASE of
KSGA_BACSU, however the E value is low for this hit.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 20 to 283 (E-value = 1e-27) place TP0337 in the RrnaAD family which is described as Ribosomal RNA adenine dimethylase (PF00398)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
13

PDB Hit:
none

Gene Protein Sequence:
MCCPNYNSARALAQFLTERGLRMHKKWGQNFLLDPVLRTQLVKILAPERG
ERVWEIGAGIGAMTALLVQNSDFLTVFEIDRGFVQTLRKLFDAHVRVIEG
DVLQQWHAAAAQEQPACVLGNLPYNIAARFIGNTIESGYIFKRMVVTVQK
EIGLRMTALPAQKWYSYFSVLCQWQYEVRVIRNVAPVCFWPRPHVVSQAL
VLTKRNAVPSCVDPALFLHVTKTLFSARRKTVRNNLLTWQKRMPGGAAVC
VEELCARAGIDARARAEQLSIYDFITLSDTLRALL

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGTTGCCCGAATTATAATTCGGCGCGTGCACTTGCACAGTTTTTGAC
GGAGCGCGGTTTGCGGATGCATAAAAAGTGGGGGCAGAATTTTCTGCTCG
ATCCGGTGTTACGTACGCAGCTTGTTAAGATATTGGCGCCGGAGCGTGGG
GAACGTGTATGGGAAATTGGTGCAGGCATTGGTGCGATGACCGCACTTTT
GGTGCAAAACAGTGATTTTTTAACAGTGTTTGAAATTGATCGCGGCTTTG
TGCAGACATTGCGCAAACTTTTTGATGCACACGTCCGTGTGATAGAAGGG
GATGTGTTGCAACAGTGGCATGCTGCAGCAGCACAGGAACAACCTGCGTG
TGTTCTAGGAAATTTACCCTACAATATTGCTGCCCGTTTTATTGGAAACA
CGATCGAATCAGGCTATATTTTTAAGCGTATGGTGGTGACCGTTCAAAAA
GAAATCGGGTTGAGAATGACTGCGCTCCCTGCACAAAAATGGTATTCATA
CTTTTCAGTACTCTGTCAGTGGCAGTATGAAGTGCGTGTGATTCGTAACG
TTGCGCCTGTCTGTTTTTGGCCGCGTCCTCATGTAGTTTCTCAAGCATTG
GTACTCACCAAGCGTAATGCGGTGCCTTCTTGTGTGGATCCTGCGCTTTT
TCTGCACGTGACGAAAACTTTGTTTTCTGCGCGGCGTAAAACGGTAAGAA
ATAATTTACTCACGTGGCAAAAAAGGATGCCAGGCGGTGCAGCTGTGTGT
GTAGAAGAACTCTGCGCACGTGCAGGTATTGACGCGCGTGCGCGTGCAGA
GCAACTGAGCATCTATGATTTTATTACGCTTTCTGATACGCTGCGCGCGC
TACTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy