Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-1 tRNA-Leu-2 IGR251 IGR248 IGR250 IGR249 IGR246 IGR247 TP0335 gnd, - TP0331 ftsH, - TP0330 TP0332 TP0333 TP0334 comE, - TP0336 glyA, - TP0329 mutS, - TP0328 TP0335 gnd, - TP0331 ftsH, - TP0330 TP0332 TP0333 TP0334 comE, - TP0336 glyA, - TP0329 mutS, - TP0328 Type: tandem, Name:  - 78 Type: tandem, Name:  - 245 TP0335 gnd, - TP0331 ftsH, - TP0330 TP0333 TP0334 comE, - TP0336 glyA, - TP0329 mutS, - TP0328 ksgA, - TP0337 ksgA, - TP0337 TP0332
* Calculated from Protein Sequence

Gene ID: TP0331

DNA Molecule Name:
1  

Genbank ID:
3322609

Gene Name:
gnd  

Definition:
phosphogluconate dehydrogenase

Gene Start:
355478

Gene Stop:
354015

Gene Length:
1464

Molecular Weight*:
52757

pI*:
7.12

Net Charge*:
0.98

EC:
1.1.1.44  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Carbohydrate metabolism; Pentose phosphate cycle

Comment:
This enzyme is involved in the hexose monophosphate shunt.

Reaction:
6-PHOSPHO-D-GLUCONATE + NADP(+) = D-RIBULOSE 5-PHOSPHATE + CO(2) + NADPH.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to phosphogluconate
dehydrogenases. For example residues 4-488 are 6PGD_HAEIN,
6-phosphogluconate dehydrogenase, decarboxylating (gnd) homolog of
Haemophilus influenzae,(U32737).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0362
COG name: 6-phosphogluconate dehydrogenase, family 1
Functional Class:  G
The phylogenetic pattern of COG0362 is ----Y-vceBrh----olin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 6-43, 67-104, 110-157, 165-205, 213-246, 249-301, 319-359,
376-429, and 430-460 represent significant (100%) hits to blocks
BL00461A-I, 6-phosphogluconate dehydrogenase proteins.

ProDom Summary:  Protein Domain Search
Residues 64-459 are 54% similar to phosphogluconate dehydrogenase of
6PGD_YEAST. Residues 5-207, 6-62 and 465-486 also support this match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 2 to 175 (E-value = 9.5e-117) place TP0331 in the NAD_binding_2 family which is described as NAD binding domain of 6-phosphogluconate dehydrogenase (PF03446)
Residues 177 to 475 (E-value = 7.2e-156) place TP0331 in the 6PGD family which is described as 6-phosphogluconate dehydrogenase, C-terminal domain (PF00393)

PDB Hit:
gi|999515|pdb|1PGN| 6-Phosphogluconate Dehydrogenase (6-Pgdh) (E.C.1.1.1.44) Complexed With Coenzyme Analogue Nicotinamide 8-Bromo-Adenine Dinucleotide Phosphate

Gene Protein Sequence:
MGADIGFIGLAVMGENLVLNIERNGFSVAVFNRTTTVVDRFLAGRAHGKR
ITGAHSIAELVSLLARPRKIMLMVKAGSAVDAVIDQILPLLEKGDLVIDG
GNSHYQDTIRRMHALEAAGIHFIGTGVSGGEEGALRGPSLMPGGSAQAWP
LVSPIFCAIAAKADDGTPCCDWVGSDGAGHYVKMIHNGIEYGDMQIIAEG
YWFMKHALGMSYEHMHHTFTRWNTGRLHSYLIEITAAILAHQDTDGTPLL
EKILDAAGQKGTGRWTCVAALEEGSPLTLITESVMARSLSAQKQARCKAH
RVFGSPVKVSKAETLSAQQREELVSALEDALYCAKIVSYAQGFELLSHTA
KRRGWTLDFSRIASLWRGGCIIRSGFLSKISAAFAQQHDLENLVLAPFFA
EELKRACPGWRTIVAESVRQALPVPALSAALAWFDGFTGAALPANLLQAQ
RDYFGAHTYERTDAPRGEFFHTNWTGTGGDTIAGTYSI

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGCGCAGACATTGGGTTCATTGGACTTGCTGTCATGGGAGAGAATCT
GGTTCTCAACATTGAGCGCAACGGTTTTTCCGTCGCAGTTTTCAATCGCA
CCACCACGGTGGTCGACCGATTTCTTGCAGGGCGCGCTCATGGCAAGCGA
ATCACCGGCGCCCACTCCATTGCAGAACTTGTTTCACTTTTGGCACGTCC
ACGCAAAATCATGCTCATGGTCAAAGCAGGCAGCGCAGTCGATGCGGTCA
TTGACCAGATACTGCCCCTTCTAGAAAAGGGGGACCTCGTTATCGACGGT
GGCAACTCTCATTACCAGGATACCATCCGGCGCATGCATGCGCTAGAGGC
CGCAGGTATTCATTTCATTGGCACAGGAGTTTCGGGGGGAGAAGAGGGGG
CCCTCCGTGGACCGTCCCTCATGCCTGGAGGCTCTGCTCAGGCTTGGCCG
TTGGTTTCTCCCATTTTCTGTGCCATTGCCGCCAAAGCCGACGATGGCAC
CCCGTGCTGCGACTGGGTCGGCAGTGATGGCGCCGGGCACTACGTGAAAA
TGATTCACAACGGCATTGAGTACGGCGACATGCAGATAATCGCCGAGGGC
TACTGGTTTATGAAGCATGCGCTGGGCATGAGCTATGAGCACATGCACCA
TACGTTTACCCGCTGGAACACGGGCCGCTTACACTCGTACCTGATTGAGA
TTACCGCGGCTATTCTGGCACATCAGGACACAGACGGCACACCACTTTTA
GAGAAAATTCTAGATGCCGCTGGACAGAAGGGGACGGGCAGGTGGACGTG
TGTTGCAGCGCTCGAAGAAGGCAGCCCGCTTACACTGATCACAGAGTCAG
TGATGGCGCGTAGTCTTTCTGCGCAAAAGCAAGCGCGCTGCAAGGCACAT
CGCGTTTTTGGTTCTCCCGTGAAAGTCTCCAAAGCAGAAACGCTAAGTGC
ACAGCAGCGCGAAGAACTGGTGTCTGCACTGGAAGACGCGCTGTATTGCG
CGAAAATAGTCTCGTATGCGCAGGGTTTTGAGCTGTTATCGCATACGGCA
AAGCGCCGAGGATGGACACTGGATTTTTCCCGGATTGCATCGCTGTGGCG
TGGCGGGTGTATTATTCGTTCAGGATTCCTGTCCAAGATCAGTGCGGCGT
TTGCTCAGCAGCACGATCTAGAGAATTTGGTACTTGCTCCCTTTTTCGCA
GAGGAATTAAAGCGTGCGTGTCCAGGCTGGCGCACCATAGTGGCAGAATC
GGTACGGCAGGCGTTGCCAGTTCCGGCCCTCTCTGCTGCGTTAGCCTGGT
TTGATGGGTTCACCGGTGCTGCTTTGCCGGCCAACCTCCTTCAGGCACAG
CGAGATTATTTTGGTGCGCACACCTACGAGCGCACAGATGCGCCGAGAGG
AGAGTTTTTTCACACAAACTGGACAGGCACCGGCGGTGATACCATTGCAG
GAACCTACTCAATA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy