Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-1 tRNA-Leu-2 IGR251 IGR248 IGR250 IGR249 IGR246 IGR247 TP0335 gnd, - TP0331 ftsH, - TP0330 TP0332 TP0333 TP0334 glyA, - TP0329 mutS, - TP0328 TP0335 gnd, - TP0331 ftsH, - TP0330 TP0332 TP0333 TP0334 glyA, - TP0329 mutS, - TP0328 Type: tandem, Name:  - 78 Type: tandem, Name:  - 245 TP0335 gnd, - TP0331 ftsH, - TP0330 TP0333 TP0334 glyA, - TP0329 mutS, - TP0328 TP0332
* Calculated from Protein Sequence

Gene ID: TP0330

DNA Molecule Name:
1  

Genbank ID:
3322608

Gene Name:
ftsH  

Definition:
probable cell division protein

Gene Start:
353782

Gene Stop:
351989

Gene Length:
1794

Molecular Weight*:
67748

pI*:
7.15

Net Charge*:
0.90

EC:
3.4.24.-  

Functional Class:
Cellular processes; Cell division  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
FtsH seems to act as an ATP-dependent zinc metallopeptidase. It
requires and binds zinc as a cofactor.

This protein may have an extra N-terminal region.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits in the C-terminal
region to cell division protein (ftsH). For example residues 275-544
are 27% similar to FTH2_SYNY3, cell division protein FtsH of
Synechocystis sp., (D90904).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0465
COG name: ATP-dependent Zn proteases
Functional Class:  O
The phylogenetic pattern of COG0465 is ----YqvCeBrHUJgpoLinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 343-364, 80-416, 116-152, 429-474, 170-215, 256-301, 169-214,
and 509-529 represent significant (100%) hits to blocks BL00674B,C,D,E,
AAA-protein family proteins.

ProDom Summary:  Protein Domain Search
Residues 448-526 are 39% similar to PEROXISOME BIOSYNTHESIS PROTEIN of
PAY4_YARLI.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0765 also cell division
protein (ftsH). Residues 342-544 are 27% similar to TP0765.

Pfam Summary:  Pfam Search
Residues 345 to 528 (E-value = 1.4e-32) place TP0330 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)

PDB Hit:
none

Gene Protein Sequence:
MHSGQQLLEKNSIIISGLPPWAQELSKKYCSKTVNLYFVHGNIRDFLPHR
DIQGSFSFVRINDYISEVIFGNRDIIVFYDKSAGLTFCLQEMLSAYLERM
HAQYPTEALADFLSRDPVKAFAYLERYFIMNMKQNKRMVLIIDYSESLVP
SEDIANLSETDRYCFVTLNRWANDPVFTNEDISVVMLTENITDINSRFTA
SPSTVKIHIPLPNEETRIRFLEYLKTQEEILVLERGLNTEKIGKLTSGLN
LVNLHQLAAETYQTIDANGKPEDNISRLSHTDSATLQFLKRKKQEIIEHE
AGGLLEFVDTSCDLSYVAGNVFVKKRLYNAVRAIKQGRADVLPMGYLISG
PIGTGKSFMVSAFAGEIGIPMVRLCNFQATQPGITQSNLEKTLNILKALT
PVAVMVDEADAVFGRRNAPAGESRIFAQIAGFMGNTQHRGNIIWFLITSR
PDLLPIDLKRQGRAEEHLALFYPETTKEKTEIFEALKKKLRIKLKDVHVP
AIIRRIKFAVSGSDLEAILVRAQLTAAMENRTMVTTQDITRTIEDFIPPA
YPHEIELQNLVAVLECTGKEMLPARYQHLDRSKLVADIRELKLLMGEK

Gene Nucleotide Sequence:  Sequence Viewer
GTGCATTCGGGGCAGCAATTACTTGAAAAGAACAGTATTATTATCAGCGG
TCTTCCCCCCTGGGCGCAGGAGTTGTCCAAGAAGTATTGCTCTAAAACGG
TCAATCTGTACTTCGTACATGGCAATATCCGTGACTTCCTCCCCCATCGC
GATATTCAGGGCAGCTTCTCCTTCGTTCGCATTAATGACTACATATCTGA
GGTTATCTTCGGTAACCGGGATATCATCGTCTTCTATGACAAATCTGCAG
GGCTCACATTTTGTCTACAAGAAATGCTGAGCGCTTACTTAGAGCGTATG
CATGCCCAGTATCCTACTGAGGCACTTGCTGACTTTCTTTCGCGTGATCC
GGTGAAAGCTTTTGCGTACCTTGAGCGCTACTTTATTATGAACATGAAAC
AGAATAAGCGTATGGTCCTCATCATCGACTATTCTGAATCTCTCGTTCCC
TCAGAAGATATTGCAAACTTAAGCGAAACAGATCGCTATTGCTTCGTCAC
CCTCAATCGCTGGGCAAATGATCCGGTGTTCACAAACGAAGACATATCCG
TTGTGATGCTCACGGAGAATATCACTGACATCAACAGTCGGTTCACCGCT
TCTCCTTCCACCGTTAAGATTCACATACCCCTGCCAAATGAAGAAACACG
GATACGCTTTCTTGAATATCTCAAAACCCAGGAGGAGATTTTAGTACTTG
AACGTGGGTTGAATACGGAGAAAATTGGCAAACTCACTTCCGGTTTGAAT
TTAGTGAACCTCCACCAGCTTGCGGCAGAGACGTACCAAACGATCGATGC
AAATGGGAAGCCAGAGGACAATATCAGTAGACTTTCCCATACGGACTCTG
CAACCTTACAATTTCTAAAAAGGAAGAAACAGGAAATTATTGAGCACGAA
GCAGGCGGTTTGTTGGAATTTGTCGACACATCCTGCGACCTTTCATACGT
TGCAGGAAATGTCTTTGTAAAAAAGAGATTGTATAACGCAGTGCGCGCCA
TTAAGCAAGGAAGAGCAGATGTGTTGCCAATGGGATACCTTATCTCAGGG
CCGATTGGGACAGGCAAATCATTTATGGTTTCCGCATTTGCGGGGGAAAT
TGGGATTCCCATGGTGCGTTTGTGTAATTTCCAGGCAACGCAGCCTGGCA
TTACACAGTCGAACCTAGAAAAAACGCTCAACATCCTCAAAGCGCTTACC
CCGGTAGCGGTGATGGTGGACGAAGCTGATGCGGTGTTTGGTAGGCGTAA
CGCGCCGGCAGGTGAATCGCGTATTTTTGCACAAATTGCAGGGTTTATGG
GTAACACCCAACACCGGGGCAATATTATTTGGTTCCTGATTACTTCGCGC
CCAGACTTGCTACCAATAGATCTGAAACGACAGGGACGCGCAGAAGAGCA
TCTTGCGCTCTTCTACCCTGAAACCACAAAAGAAAAAACGGAAATTTTTG
AAGCACTCAAAAAAAAATTACGTATCAAGCTCAAAGATGTACACGTACCG
GCAATCATTCGCAGAATAAAATTCGCTGTTTCCGGTTCGGACTTAGAAGC
CATTTTAGTACGCGCCCAGCTAACTGCTGCGATGGAAAATCGCACGATGG
TAACCACACAGGACATCACCCGCACCATTGAAGACTTTATCCCTCCTGCT
TATCCGCACGAAATTGAACTGCAAAATTTAGTGGCAGTACTCGAATGCAC
AGGAAAGGAAATGCTCCCTGCGCGTTATCAGCATTTAGATCGCTCTAAAC
TGGTGGCAGATATTCGGGAACTAAAACTCCTCATGGGAGAAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy