Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap tRNA-Gly-1 tRNA-Leu-2 IGR248 IGR249 IGR245 IGR244 IGR246 IGR247 gnd, - TP0331 ftsH, - TP0330 TP0332 ompH, - TP0327 TP0333 glyA, - TP0329 TP0326 mutS, - TP0328 gnd, - TP0331 ftsH, - TP0330 TP0332 ompH, - TP0327 TP0333 glyA, - TP0329 TP0326 mutS, - TP0328 Type: tandem, Name:  - 77 Type: tandem, Name:  - 78 gnd, - TP0331 ftsH, - TP0330 ompH, - TP0327 TP0333 glyA, - TP0329 TP0326 mutS, - TP0328 TP0332
* Calculated from Protein Sequence

Gene ID: TP0329

DNA Molecule Name:
1  

Genbank ID:
3322607

Gene Name:
glyA  

Definition:
serine hydroxymethyltransferase

Gene Start:
350288

Gene Stop:
352009

Gene Length:
1722

Molecular Weight*:
62679

pI*:
8.20

Net Charge*:
7.94

EC:
2.1.2.1  

Functional Class:
Amino acid biosynthesis; Serine family  

Pathway: pathway table
Metabolism of cofactors, vitamins, and other substances; One carbon pool by folate

Comment:
This protein is a key enzyme in the biosynthesis of purines, lipids,
hormones and other components. It is involved in the interconversion
of serine and glycine and requires pyridoxal phosphate.

Reaction:
5,10-METHYLENETETRAHYDROFOLATE + GLYCINE + H(2)O =
TETRAHYDROFOLATE + L-SERINE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several hits to serine hydroxymethyltransferases.
For example residues 35-491 are 41% similar to GLYA_BACSU, serine
hydroxymethyltransferase of Bacillus subtilis, (Z38002).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0112
COG name: Glycine hydroxymethyltransferase
Functional Class:  E
The phylogenetic pattern of COG0112 is amtkYqvcebRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 36-81, 97-137, 206-251, 255-296, 252-293, 306-346, 361-405,
194-238, and 410-434 represent significant (100%) hits to blocks
BL00096A,B,C,D,E,F,G, Serine hydroxymethyltransferase
pyridoxal-phosphate attachment.

ProDom Summary:  Protein Domain Search
Residues 171-267 are 58% similar to serine hydroxymethyltransferase
of GLYA_SYNY3. Residues 43-134, 282-364 and 366-445 also support this
match.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 32 to 441 (E-value = 2.2e-147) place TP0329 in the SHMT family which is described as Serine hydroxymethyltransferase (PF00464)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
413  
505

PDB Hit:
none

Gene Protein Sequence:
MNNSALRAYLSTRAPDQIHSAFVAYLANLDLVAHQFPQIASDIVQELIDQ
RSYVKLIASENYSSLAVQAAMANLLTDKYAEGFPHHRYYGGCQNVDSIES
AAAAEACALFGAEHAYVQPHSGADANLVAFWAILSRQIEMPTLSSLGVTA
ATHLSEEQWEVLRQKMGNQKLMGLDYFSGGHLTHGYRQNVSGRMFRVVSY
AVDRDTGLLDYAAIEAQAKRERPLILLAGYSAYPRSINFRIFREIADKVG
AVLMADMAHFAGLVAGGVFTGDEDPVRWSHIVTSTTHKTLRGPRGAFILC
KKEFAEAVDKGCPLVLGGPLPHVMAAKAVAFREARNAAFKTYAHAVRDNA
RALADACIQQGMQLQTGGTDNHLLLLDVRPFGLTGRQAERALIDCGVTLN
RNSLPFDPNGAWLTSGLRIGTPAVTSLGMGPEEMKRIARLIARVLGAATP
VRTKTGALSKSAAEVPGEVRSSVCSEVRELLARFTLYPELDEPFLRAHFT
RRPAGQNTCRRRDLNPYGVTPTDFESVVSASFTTSARAQPITRGTKGTAV
HVVFLREAPCLPLREPLFFSHEEF

Gene Nucleotide Sequence:  Sequence Viewer
GTGAATAATTCCGCACTCCGTGCGTACCTGAGTACGCGTGCTCCTGACCA
GATACATAGTGCTTTTGTTGCGTATTTGGCCAATCTTGATTTAGTTGCGC
ACCAGTTTCCGCAGATTGCTTCTGATATTGTGCAGGAGCTGATAGATCAG
CGGTCGTATGTAAAGTTAATCGCAAGTGAGAATTACAGCTCTCTTGCGGT
GCAAGCGGCGATGGCTAACTTGTTGACTGATAAATACGCAGAAGGGTTCC
CCCATCATCGCTACTATGGCGGGTGTCAGAATGTTGATTCTATTGAGTCT
GCCGCCGCTGCAGAAGCATGCGCGCTCTTTGGTGCTGAGCACGCATATGT
CCAGCCGCACTCCGGTGCAGATGCGAATCTTGTTGCATTCTGGGCTATCC
TTTCGCGGCAAATTGAAATGCCAACCCTTTCTTCTCTTGGTGTCACCGCC
GCTACGCATCTGAGTGAGGAACAGTGGGAAGTACTGCGCCAGAAAATGGG
TAATCAAAAACTTATGGGGTTAGATTATTTTTCAGGCGGTCACCTGACCC
ACGGGTACCGCCAAAATGTTTCAGGACGAATGTTTCGTGTGGTGTCCTAC
GCGGTGGACCGAGACACAGGACTGCTCGATTACGCTGCAATCGAGGCACA
GGCAAAGCGGGAAAGACCACTTATTTTACTTGCCGGATACAGCGCGTATC
CTCGTTCCATTAATTTCCGCATCTTTCGGGAAATTGCAGACAAAGTGGGC
GCAGTACTCATGGCTGATATGGCTCACTTTGCTGGACTGGTTGCAGGCGG
TGTTTTTACGGGAGACGAGGATCCAGTGCGCTGGTCTCATATCGTGACCA
GTACCACACACAAAACGTTGCGCGGGCCACGCGGTGCCTTTATTTTGTGT
AAAAAAGAATTTGCAGAGGCGGTGGATAAGGGCTGTCCGCTTGTGCTCGG
CGGCCCGCTGCCACATGTGATGGCAGCAAAGGCGGTTGCGTTTCGTGAAG
CTCGAAATGCTGCTTTTAAAACCTATGCGCACGCAGTCCGTGATAATGCG
CGTGCGCTGGCAGATGCCTGCATACAACAGGGGATGCAGCTGCAGACAGG
GGGGACGGATAACCATCTGCTATTGCTTGACGTGCGTCCGTTTGGACTGA
CAGGTCGTCAGGCAGAGCGCGCGCTGATAGACTGCGGAGTGACGCTCAAC
CGTAACTCGCTCCCCTTTGACCCAAACGGCGCATGGCTCACCAGCGGACT
GCGCATCGGAACCCCCGCGGTAACGAGCCTTGGAATGGGGCCTGAGGAAA
TGAAAAGAATAGCGCGCCTGATCGCGCGCGTGCTCGGCGCTGCAACGCCT
GTGCGGACAAAGACAGGTGCGCTAAGCAAATCGGCGGCCGAGGTGCCCGG
CGAGGTTAGAAGCTCAGTCTGCTCGGAAGTGCGGGAGCTGCTCGCACGCT
TCACGTTGTACCCTGAACTCGACGAACCCTTCTTGCGCGCACACTTTACG
CGTCGCCCTGCGGGACAAAACACCTGCCGACGAAGGGACTTGAACCCTTA
CGGGGTTACCCCAACAGATTTTGAGTCTGTCGTGTCTGCCAGTTTCACCA
CGTCGGCCCGCGCGCAGCCTATCACACGAGGAACAAAAGGTACAGCTGTT
CATGTAGTCTTCTTGCGTGAGGCCCCGTGTCTCCCATTGAGGGAGCCGTT
ATTTTTCTCCCATGAGGAGTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy