Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR232 IGR235 IGR234 IGR233 TP0311 mutL, - TP0303 TP0304 rpsD, - TP0306 fliY, - TP0309 TP0307 pyrG, - TP0305 TP0311 mutL, - TP0303 TP0304 rpsD, - TP0306 fliY, - TP0309 TP0307 pyrG, - TP0305 Type: tandem, Name:  - 243 mutL, - TP0303 TP0304 tprF, - TP0316A TP0311 tprF, - TP0316A rpsD, - TP0306 fliY, - TP0309 TP0307 pyrG, - TP0305 TP0310 TP0308 TP0310 TP0308
* Calculated from Protein Sequence

Gene ID: TP0305

DNA Molecule Name:
1  

Genbank ID:
3322579

Gene Name:
pyrG  

Definition:
CTP synthase

Gene Start:
320972

Gene Stop:
322702

Gene Length:
1731

Molecular Weight*:
62137

pI*:
7.07

Net Charge*:
0.66

EC:
6.3.4.2  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Nucleotide metabolism; Pyrimidine Metabolism

Comment:
This protein is the last step in pyrimidine biosynthesis and is
activated by GTP and inhibited by CTP.

Reaction:
ATP + UTP + GLUTAMINE = ADP + ORTHOPHOSPHATE + CTP
(AMMONIA CAN REPLACE GLUTAMINE)

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to CTP synthases. For
example residues 5-570 are 46% similar to CTP synthetase of Synechococcus
PCC7942, (U59237).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0504
COG name: CTP synthase (UTP-ammonia lyase)
Functional Class:  F
The phylogenetic pattern of COG0504 is amtkYqvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 418-427, 542-552, and 448-458 represent significant (100%)
hits to blocks BL00442A,B, Glutamine amidotransferases class-I
proteins. Residues 385-401 and 534-567 represent significant (96%)
hits to blocks BL01236A,E, Uncharacterized protein family UPF0030
proteins.

ProDom Summary:  Protein Domain Search
Residues 5-250 are 55% similar to CTP synthase of PYRG_SYNP7.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 3 to 280 (E-value = 1.9e-189) place TP0305 in the CTP_synth_N family which is described as CTP synthase N-terminus (PF06418)
Residues 342 to 568 (E-value = 2.4e-49) place TP0305 in the GATase family which is described as Glutamine amidotransferase class-I (PF00117)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
90  
170
non-globular  
249  
365
non-globular  
437  
545

PDB Hit:
none

Gene Protein Sequence:
MDPAFIFITGGVVSSLGKGIAAGAIGLLLKSRGISVVNQKFDPYLNGDPG
TMNPYQHGEVFVTQDGGETDLDLGHYERFTDVPSSRFNSTTAGSVYRAIL
DRERAGGYGGATVQVIPHVTDEIQARIRAAAATTGARVVITEIGGTVGDI
ESLPFIEAIRQIRRVLGKERCLFIHLGLVPYLPSCGEMKTKPLQHSVKEL
LGLGVQPDVILCRSERHITDAVREKLSLFCNVERRAIVENVTARSIYEVP
LLLEAEGLGALLCERLRLFDTCCGGQVARNLGAGGAQSAVLGAGGTVRTD
GGLHPAAGQGAEPDLTAWRAMVRALYYPRRELTVALVGKYVSLADAYLSV
SEALTAAGICHRARVDMRWIDAEEICSVQDAGHALADADALVIPGGFGVR
GIEGMICAVSHARVQNLPYLGICLGMQIAVIEFARNVLLLASAHSREFAV
DTPHPVVDLLPGCVDTPTGGSLRLGQYRCLLAEGSRARALYGRGEVWERH
RHRYGLNAAYRARFEASALRPVGVDSDCGAVEVVEHGEHPWFFGVQFHPE
FCSRPNRAHPLFRALVAAGLERKDSRS

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATCCGGCTTTTATCTTTATTACAGGCGGTGTAGTTTCCTCGCTGGG
CAAGGGTATTGCCGCAGGTGCCATCGGACTTTTGCTTAAGAGCCGGGGTA
TATCCGTGGTGAATCAAAAGTTTGATCCCTACCTGAATGGGGATCCCGGT
ACCATGAATCCCTATCAGCACGGGGAGGTGTTTGTCACGCAAGATGGCGG
CGAAACGGACCTGGATCTGGGCCATTACGAGCGCTTCACGGACGTGCCTT
CAAGTAGATTCAATAGCACGACTGCGGGGAGCGTGTACCGGGCTATTTTG
GACCGTGAACGCGCGGGAGGATACGGAGGTGCTACCGTACAGGTTATTCC
TCACGTTACGGATGAAATCCAGGCGCGAATTCGCGCCGCTGCTGCTACCA
CGGGGGCTCGGGTGGTTATCACCGAAATCGGTGGTACCGTCGGTGACATA
GAGTCGCTTCCGTTCATCGAGGCGATTCGTCAAATCAGGCGTGTTCTGGG
GAAGGAGCGCTGTCTTTTTATTCATTTGGGTTTAGTTCCCTACTTACCCA
GTTGTGGTGAAATGAAAACCAAGCCGCTACAGCACAGCGTAAAGGAGCTG
CTAGGACTTGGTGTGCAGCCGGATGTCATCCTGTGCCGCAGCGAGCGTCA
CATCACGGATGCGGTGCGCGAAAAGCTGAGCCTTTTTTGCAATGTTGAGC
GGCGTGCTATTGTCGAGAACGTGACGGCTCGTTCTATCTATGAGGTGCCG
CTCCTTTTGGAAGCAGAAGGGCTGGGAGCGCTCTTGTGTGAGCGTTTGCG
TCTTTTTGATACCTGCTGCGGGGGGCAGGTGGCGCGTAATCTCGGTGCAG
GAGGCGCGCAGTCGGCTGTGTTGGGAGCGGGGGGGACGGTCCGTACAGAC
GGTGGTCTGCATCCTGCAGCAGGGCAGGGGGCAGAGCCAGATCTTACGGC
GTGGCGCGCAATGGTCCGTGCACTGTACTATCCGCGGCGGGAGCTTACGG
TGGCGCTGGTGGGTAAGTATGTGTCGCTTGCGGACGCGTATTTGAGCGTG
AGCGAAGCGTTGACGGCGGCGGGTATTTGCCATCGTGCGCGAGTGGACAT
GCGCTGGATAGACGCAGAGGAAATCTGCAGCGTGCAGGACGCTGGGCACG
CTCTTGCGGACGCAGATGCGCTGGTAATTCCAGGTGGCTTTGGCGTGCGG
GGGATTGAAGGGATGATCTGTGCAGTTTCGCACGCGCGTGTGCAGAACCT
GCCCTATCTTGGCATTTGCTTGGGGATGCAGATTGCAGTCATTGAATTTG
CGCGCAATGTACTGTTGCTGGCAAGTGCACACTCTCGAGAATTTGCGGTA
GACACCCCTCACCCGGTTGTTGATCTTTTGCCCGGTTGTGTAGATACCCC
AACGGGTGGAAGCCTGCGTCTGGGACAGTATCGCTGTCTGCTTGCGGAAG
GTTCGCGCGCGCGTGCACTGTACGGTAGGGGGGAGGTCTGGGAGCGGCAC
CGGCACCGCTATGGGTTGAACGCGGCGTATCGAGCGCGCTTTGAGGCGAG
CGCGTTGCGTCCGGTGGGAGTGGATTCAGACTGTGGCGCAGTGGAGGTGG
TGGAGCACGGGGAGCATCCGTGGTTTTTCGGCGTGCAGTTCCACCCGGAA
TTTTGTTCTCGACCGAACCGGGCTCACCCTTTGTTCCGGGCGCTGGTGGC
GGCGGGCTTGGAGCGAAAAGACAGTCGTTCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy