Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR229 IGR230 IGR231 mutL, - TP0303 TP0297 tpN38, - TP0298 rbsC, - TP0301 xylB, - TP0295 prs, - TP0294 rbsA, - TP0300 mutL, - TP0303 TP0297 tpN38, - TP0298 rbsC, - TP0301 xylB, - TP0295 prs, - TP0294 rbsA, - TP0300 Type: tandem, Name:  - 73 Type: tandem, Name:  - 242 mutL, - TP0303 TP0297 tpN38, - TP0298 rbsC, - TP0301 xylB, - TP0295 prs, - TP0294 rbsA, - TP0300 TP0299 TP0296 TP0302 TP0299 TP0296 TP0302
* Calculated from Protein Sequence

Gene ID: TP0299

DNA Molecule Name:
1  

Genbank ID:
3322580

Gene Name:


Definition:
hypothetical protein (basic)

Gene Start:
312159

Gene Stop:
312380

Gene Length:
222

Molecular Weight*:
7912

pI*:
11.40

Net Charge*:
7.08

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:
TP0299 is squeezed between TP0298 and TP0300, two possible elements in an ABC transporter operon. Is TP0299 expressed?

Please go to...
http://www.stdgen.lanl.gov

ABC transporters

Treponema pallidum

Data table
NBD Amino Acid Alignment
NBD Organization
Plasma membrane Organization

for a complete listing of Treponema pallidum ABC transporters,
alignments of transporters, nucleotide binding domain organization,and plasma membrane organization.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
Residues 17-34 and 48-65 are matched to block BL00903B, concerned with cytidine and deoxycytidylate deaminase sequences, e.g. BSR_BACCE.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in T.pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MMIAERGVRASARGVLSLHHIGKTYPRVMPRSKRGVWGMFGHPGRRAVDD
AHTAHGPCSGARETDALSTACSAM

Gene Nucleotide Sequence:  Sequence Viewer
TTGATGATAGCTGAGCGCGGCGTTAGGGCATCTGCGCGCGGTGTGCTCTC
GCTTCACCATATTGGGAAAACCTACCCGCGCGTGATGCCGCGTTCAAAGC
GCGGGGTCTGGGGTATGTTCGGTCACCCTGGCAGGCGCGCAGTCGACGAT
GCGCACACAGCGCATGGCCCGTGTTCGGGCGCGCGTGAGACGGACGCGCT
GAGCACAGCGTGCTCAGCGATG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy