Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR228 IGR229 IGR230 IGR231 TP0297 tpN38, - TP0298 rbsC, - TP0301 xylB, - TP0295 TpN50, - TP0292 prs, - TP0294 rbsA, - TP0300 TP0297 tpN38, - TP0298 rbsC, - TP0301 xylB, - TP0295 TpN50, - TP0292 prs, - TP0294 rbsA, - TP0300 Type: tandem, Name:  - 73 Type: tandem, Name:  - 242 TP0297 tpN38, - TP0298 rbsC, - TP0301 xylB, - TP0295 TpN50, - TP0292 prs, - TP0294 rbsA, - TP0300 TP0293 TP0299 TP0296 TP0291 TP0293 TP0299 TP0296 TP0291
* Calculated from Protein Sequence

Gene ID: TP0296

DNA Molecule Name:
1  

Genbank ID:
3322572

Gene Name:


Definition:
conserved hypothetical protein (basic)

Gene Start:
309587

Gene Stop:
310219

Gene Length:
633

Molecular Weight*:
23568

pI*:
10.52

Net Charge*:
14.82

EC:
 

Functional Class:
Conserved hypothetical  

Pathway: pathway table

Comment:
This protein likely binds ATP.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several hits to hypothetical proteins. Several
iterations of PSI-BLAST did not yield any further information. For
example residues 7-207 are 28% similar to YACE_PSEPU, a hypothetical
protein of Pseudomonas putida,(X74276).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0237
COG name: Predicted ATPase
Functional Class:  R
The phylogenetic pattern of COG0237 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 7-158 are 31% similar to YACE_PSEPU, a hypothetical protein
which is a member of the UPF0038 family, ATP-binding proteins.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 6 to 182 (E-value = 2.6e-07) place TP0296 in the CoaE family which is described as Dephospho-CoA kinase (PF01121)

PDB Hit:
none

Gene Protein Sequence:
MREFCPLIGVIGRSGAGKNVVSRLLAERGCYCIDADARTRELLESYGDSI
VERFQVAAAARGLSLRRKDGGLHSAHLGVLLFSEPKLLQQHEEFLLPKVT
RLLCEDIARAQAARPKAIVLNAPTLHKTELLQACSFVLYIWAPSILRMWR
CKKRERVSFTHLLRRFSAQKGFYAQSIAQNADTYTVANCGRVASLARKVD
CILTRRGVLGE

Gene Nucleotide Sequence:  Sequence Viewer
GTGCGCGAGTTTTGTCCACTAATTGGTGTCATCGGTCGAAGTGGTGCGGG
GAAGAATGTGGTCTCGCGCCTGCTTGCAGAACGGGGATGTTACTGTATTG
ACGCGGATGCGCGCACGCGTGAACTTTTGGAATCTTATGGCGACTCTATA
GTAGAGCGGTTTCAAGTGGCTGCGGCTGCGCGCGGCCTTTCGTTACGGCG
TAAAGATGGCGGCCTGCACTCTGCGCATTTGGGTGTGTTACTGTTCTCTG
AGCCTAAACTACTGCAGCAGCACGAAGAGTTTTTGTTACCGAAAGTTACC
CGTCTTTTGTGTGAAGACATAGCGCGCGCGCAGGCTGCGCGTCCAAAAGC
GATAGTACTGAATGCGCCGACATTGCATAAAACAGAACTGTTACAAGCCT
GTAGTTTTGTTTTGTACATATGGGCGCCAAGCATACTGCGCATGTGGCGA
TGTAAGAAACGGGAACGAGTATCTTTTACTCACCTTTTACGCAGGTTTTC
TGCGCAGAAGGGTTTCTATGCTCAAAGCATCGCGCAAAACGCCGATACCT
ACACGGTGGCCAACTGTGGGCGTGTTGCGTCATTGGCGCGAAAAGTCGAT
TGCATTCTGACGCGCAGGGGTGTTTTAGGCGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy