Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR228 IGR229 IGR227 IGR230 IGR231 TP0297 TP0290 tpN38, - TP0298 xylB, - TP0295 TpN50, - TP0292 prs, - TP0294 rbsA, - TP0300 TP0297 TP0290 tpN38, - TP0298 xylB, - TP0295 TpN50, - TP0292 prs, - TP0294 rbsA, - TP0300 Type: tandem, Name:  - 242 TP0297 TP0290 tpN38, - TP0298 xylB, - TP0295 TpN50, - TP0292 prs, - TP0294 rbsA, - TP0300 TP0293 TP0299 TP0296 TP0291 TP0293 TP0299 TP0296 TP0291
* Calculated from Protein Sequence

Gene ID: TP0295

DNA Molecule Name:
1  

Genbank ID:
3322560

Gene Name:
xylB  

Definition:
xylulokinase

Gene Start:
308257

Gene Stop:
309498

Gene Length:
1242

Molecular Weight*:
45543

pI*:
8.34

Net Charge*:
8.14

EC:
2.7.1.17  

Functional Class:
Energy metabolism; Sugars  

Pathway: pathway table
Miscellaneous Enzymes

Comment:
This protein phosphorylates xylulose.

Reaction:
ATP + D-XYLULOSE = ADP + D-XYLULOSE 5-PHOSPHATE.

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed three significant hits to xylulokinases. For
example residues 9-400 are 20% similar to XYLB_BACSU, xylulose kinase
of Bacillus subtilis,(U66480).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1070
COG name: Sugar (pentulose and hexulose) kinases
Functional Class:  G
The phylogenetic pattern of COG1070 is A---y-VcEBrH----ol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 4-27, 223-236, 291-313, and 329-363 represent significant (99%)
hits to blocks BL00933A,B,D,E, FGGY family of carbohydrate kinases
proteins.

ProDom Summary:  Protein Domain Search
Residues 328-404 are 33% similar to YDEV_ECOLI, a hypothetical protein
belonging to a family of fucokinase, gluconokinase, glycerokinase and
xylulokinase.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 5 to 199 (E-value = 4.9e-07) place TP0295 in the FGGY_N family which is described as FGGY family of carbohydrate kinases, N-terminal domain (PF00370)

PDB Hit:
none

Gene Protein Sequence:
MGSGIFVADIGTSSLKAAIISQDGKVLQYQRVFFPQPVKAQDWVRSFFTV
FERLRAVHHVIAITISGNGPSVVAVHKKSHAEDQLILWNQAGASDPRCGV
SLFLPKVLLLLQRLHFCARDVQFFLSSHEYLIYRLTGCAVTVLPERRYMP
TYWTSESLRACALPETLFAPFVAPGSIVASYRGIPVVCGAPDFAAALIGT
NTLHAGSGCDRAGSSEGLNVCVRLPPAIRSADARVRVLPSLRADFWNVSF
LIADSGSRFASYMRRTHAQGFGERMGQIMALPFQLHDAYPPTVVGEGRQL
VEDLAFEVCAGLEYLESVTQLQPVYTVSGGQAKDSRWLQLKADVSGRCFV
LPEIHDAELTGNAALACVALDFDADMQTAAQRLCRLKREFIPNRARHEQY
AQKRLLRAAREAQG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTTCGGGGATCTTTGTCGCGGACATCGGTACGTCTTCCCTAAAAGC
GGCGATTATTTCCCAAGATGGAAAGGTGTTACAGTACCAGCGCGTGTTCT
TTCCTCAGCCGGTGAAGGCCCAGGATTGGGTGCGTTCATTTTTTACGGTG
TTTGAGCGGTTGCGTGCCGTGCATCACGTTATTGCCATTACTATTTCGGG
CAATGGACCGAGCGTCGTTGCCGTGCACAAGAAGAGTCATGCCGAGGATC
AACTGATTTTGTGGAATCAAGCGGGGGCGTCTGATCCCCGGTGCGGTGTT
TCTCTTTTTTTGCCAAAGGTTTTGCTCCTTTTGCAGCGATTGCATTTTTG
TGCGCGTGATGTACAGTTTTTTCTTTCTTCTCACGAATACTTGATATATC
GACTCACGGGGTGTGCGGTTACGGTATTACCAGAGCGACGTTACATGCCG
ACGTACTGGACGTCTGAGAGTTTACGCGCGTGTGCGTTACCTGAAACGCT
CTTTGCGCCGTTCGTGGCTCCTGGCTCAATTGTTGCCTCCTATCGGGGAA
TACCGGTAGTCTGCGGCGCGCCGGACTTTGCGGCAGCACTCATTGGAACA
AATACGTTACATGCAGGGAGCGGATGCGATCGGGCAGGATCCAGCGAGGG
GTTAAATGTATGTGTTCGTCTGCCTCCTGCGATCAGGTCTGCGGATGCAA
GGGTCCGCGTGTTACCGTCTTTGAGAGCAGATTTTTGGAATGTCTCGTTT
TTAATTGCGGATTCAGGGAGTCGTTTTGCCTCTTATATGCGGCGCACCCA
TGCTCAAGGGTTTGGGGAACGGATGGGTCAAATTATGGCGTTACCTTTTC
AGCTGCATGATGCGTATCCCCCCACCGTGGTGGGAGAAGGGAGACAGCTG
GTAGAGGATCTTGCCTTTGAGGTGTGTGCAGGTCTGGAGTATCTGGAGTC
TGTGACCCAGTTGCAACCGGTATACACCGTTTCAGGTGGACAGGCAAAGG
ATAGTCGTTGGTTGCAGCTTAAGGCTGATGTCAGTGGGCGTTGTTTTGTG
TTACCAGAAATTCATGACGCAGAACTGACAGGAAACGCGGCGCTCGCGTG
TGTTGCCTTGGATTTTGATGCGGATATGCAAACAGCAGCGCAACGGCTGT
GTCGTCTCAAGCGTGAGTTTATTCCCAACCGTGCCAGACACGAACAGTAT
GCACAGAAGCGTCTTTTGCGTGCTGCGCGTGAGGCACAGGGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy