Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR224 IGR228 IGR229 IGR225 IGR227 IGR226 IGR230 IGR231 TP0287 TP0297 TP0290 spsF, - TP0288 tpN38, - TP0298 xylB, - TP0295 TpN50, - TP0292 prs, - TP0294 TP0289 TP0287 TP0297 TP0290 spsF, - TP0288 tpN38, - TP0298 xylB, - TP0295 TpN50, - TP0292 prs, - TP0294 TP0289 Type: tandem, Name:  - 290 Type: tandem, Name:  - 72 Type: tandem, Name:  - 241 Type: tandem, Name:  - 242 TP0290 spsF, - TP0288 tpN38, - TP0298 xylB, - TP0295 TpN50, - TP0292 prs, - TP0294 TP0289 TP0293 TP0296 TP0291 TP0293 TP0296 TP0291 TP0287 TP0297
* Calculated from Protein Sequence

Gene ID: TP0292

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
TpN50  

Definition:
outer membrane protein (ompA-homolog)

Gene Start:
305554

Gene Stop:
306804

Gene Length:
1251

Molecular Weight*:
47597

pI*:
6.88

Net Charge*:
-0.83

EC:
 

Functional Class:
Cell envelope; Membranes, lipoproteins, and porins  

Pathway: pathway table

Primary Evidence:
Walker EM, Howell JK, You Y, Hoffmaster AR, Heath JD, Weinstock GM, Norris SJ.
Physical map of the genome of Treponema pallidum subsp. pallidum (Nichols).
J Bacteriol. 1995 Apr;177(7):1797-804.
PMID: 7896703

Cox DL, Akins DR, Porcella SF, Norgard MV, Radolf JD.
Treponema pallidum in gel microdroplets: a novel strategy for investigation of treponemal molecular architecture.
Mol Microbiol. 1995 Mar;15(6):1151-64.
PMID: 7623668

Hardham JM, Stamm LV.
Identification and characterization of the Treponema pallidum tpn50 gene, an ompA homolog.
Infect Immun. 1994 Mar;62(3):1015-25.
PMID: 8112835

Comment:
This protein could function as a porin and may be involved in membrane
intergity via peptidoglycan interaction.

This protein has been previously described as TpN50 protein which is
functionally equivalent to the E. coli OmpA protein.

Reference: PubMed (8112835)
Infect. Immun. 62 (3), 1015-1025 (1994)

Blast Summary:  PSI-Blast Search
Gapped BLAST revealed that this protein is identical to TP50_TREPA,
TpN50 precursor of Treponema pallidum, (U02628).

COGS Summary:  COGS Search
BeTs to 9 clades of COG1360
COG name: Flagellar motor protein MotB
Functional Class:? N
The phylogenetic pattern of COG1360 is -----Qv-EBrHUJ--OLinx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
Residues 110-123, 343-390 and 405-414 represent significant (100%)
hits to blocks BL01068A,B,C, OmpA-like domain proteins.

ProDom Summary:  Protein Domain Search
This protein is identical to OUTER MEMBRANE PROTEIN TPN50 PRECURSOR of
TP50_TREPA.

Paralogs:  Local Blast Search
This protein is paralogously related to TP0624 a conserved
hypothetical protein. Residues 282-415 are 32% similar to TP0624.

Pfam Summary:  Pfam Search
Residues 312 to 408 (E-value = 1.2e-42) place TP0292 in the OmpA family which is described as OmpA family (PF00691)

Structural Feature(s):
Feature Type  Start  Stop
gram positive/gram negative signal  
1  
25
non-globular  
311  
384

PDB Hit:
None

Gene Protein Sequence:
MCMMGSVFSRKGMLCVLAVWCAASAAYPLRLRYKFRKGDTHRINSLIRED
VFVNDTLAHTAEITNRITVHVSEVRVAHGSAPDAARYVCHFMTSEKSPNN
TFRWGRHYESIFWRDAFGVYDIDRSFFMPVVRNVPVFPDYDIEVGDTWEH
EAEEAHDLRDGFGIQTPFIVPFTVSYTYRGEVQRGSRRYHHITAAYSMSY
ESPKRTHGVQRNAKEGMYPVRTTGVSKQNLYWDNELGNIAEYDDEFRILL
YLSGGTVLRYQGTATAKNFAPERFDPARTVVELQETLKDLHMPDAKVRET
EEGVTISIENVQFDADSASLAPSEYEKLRKIAELLRAFPDRELLVSGHAA
RRGSVQDQQRISEERADVVARYLQELGVVDAAHVYTRGCGAQQSIAPNDS
EDGRRKNRRVEITIISK

Gene Nucleotide Sequence:  Sequence Viewer
GTGTGTATGATGGGAAGTGTGTTTTCTAGGAAGGGAATGCTGTGTGTTCT
TGCAGTCTGGTGCGCGGCAAGTGCGGCGTACCCTCTGCGCTTGCGCTACA
AGTTTCGTAAGGGGGATACGCACCGTATCAACTCGCTGATACGCGAGGAT
GTGTTTGTGAACGATACGCTTGCTCACACGGCGGAGATTACGAATCGAAT
CACGGTGCATGTTTCCGAAGTACGTGTTGCACACGGGTCGGCGCCTGATG
CGGCGCGGTATGTGTGTCACTTCATGACATCCGAGAAAAGTCCCAATAAT
ACGTTTCGTTGGGGGAGGCACTACGAAAGTATTTTCTGGCGCGACGCATT
TGGTGTGTATGATATTGATCGTTCATTCTTCATGCCGGTAGTACGGAATG
TGCCGGTGTTTCCTGATTATGATATCGAAGTTGGAGATACCTGGGAGCAT
GAAGCAGAAGAAGCGCATGATCTGCGTGACGGCTTTGGTATCCAAACGCC
CTTCATTGTGCCGTTTACCGTGTCGTATACCTACCGTGGTGAAGTTCAGC
GTGGTAGTCGGCGCTATCATCACATTACTGCGGCGTATTCTATGAGTTAT
GAGTCGCCCAAACGGACACATGGCGTGCAGCGCAATGCAAAAGAAGGAAT
GTATCCGGTGCGTACTACGGGCGTTTCTAAGCAAAATTTGTATTGGGATA
ACGAACTTGGGAACATAGCTGAGTACGACGATGAGTTTCGCATTCTCTTA
TACCTGAGTGGAGGAACGGTTTTGAGATATCAGGGTACTGCGACGGCAAA
GAATTTTGCACCTGAGCGCTTTGATCCTGCACGCACGGTGGTGGAACTGC
AAGAAACGCTCAAGGACTTGCATATGCCTGATGCGAAGGTGCGTGAAACA
GAAGAGGGAGTAACCATCAGTATAGAAAATGTTCAATTTGACGCAGACTC
TGCATCCCTTGCACCTTCTGAGTACGAGAAGCTGCGCAAAATAGCAGAAC
TTTTGCGCGCGTTTCCCGATCGAGAGTTGTTGGTGTCTGGACATGCGGCA
CGACGGGGGTCTGTGCAGGATCAACAGAGGATTTCTGAAGAGCGTGCTGA
TGTGGTTGCACGTTACCTGCAGGAATTAGGTGTTGTGGATGCAGCGCATG
TATATACGCGCGGTTGTGGTGCGCAGCAGTCTATTGCGCCAAATGATTCA
GAGGATGGTCGTAGAAAAAACCGACGGGTAGAAATCACTATCATAAGTAA
G


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy