Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR224 IGR228 IGR229 IGR225 IGR227 IGR226 TP0287 TP0290 spsF, - TP0288 TP0285 xylB, - TP0295 TpN50, - TP0292 prs, - TP0294 TP0289 TP0287 TP0290 spsF, - TP0288 TP0285 xylB, - TP0295 TpN50, - TP0292 prs, - TP0294 TP0289 Type: tandem, Name:  - 72 Type: tandem, Name:  - 241 Type: tandem, Name:  - 290 TP0290 spsF, - TP0288 TP0285 xylB, - TP0295 TpN50, - TP0292 prs, - TP0294 TP0289 TP0293 TP0286 TP0284 TP0291 TP0293 TP0291 TP0287 TP0284 TP0286
* Calculated from Protein Sequence

Gene ID: TP0290

DNA Molecule Name:
1  

Genbank ID:
3322557

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
303812

Gene Stop:
304642

Gene Length:
831

Molecular Weight*:
30925

pI*:
6.67

Net Charge*:
-1.87

EC:
 

Functional Class:
Conserved hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed several significant hits to hypothetical proteins.
Several iterations of PSI-BLAST did not reveal any new information.
For example residues 6-267 are 27% similar to a hypothetical protein
of Bacillus subtilis, (Z92954).

COGS Summary:  COGS Search
BeTs to 12 clades of COG0561
COG name: Predicted hydrolases of the HAD superfamily
Functional Class:  R
The phylogenetic pattern of COG0561 is a-tky-vCEBrH--GPOlin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 12-30, 31-55, 189-204 and 222-246 represent significant (99%+)
hits to blocks BL01228A,B,C,D, Hypothetical cof family proteins.
Residues 108-126 represent significant (97%) hits to block BL00477A,
Alpha-2-macroglobulin family thiolester region proteins.

ProDom Summary:  Protein Domain Search
Residues 7-113 are 27% similar to Y125_MYCCA, a hypothetical protein.
Residues 7-62, 12-130, 192-235 and 203-251 also match hypothetical
proteins.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 6 to 247 (E-value = 1.1e-14) place TP0290 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)

PDB Hit:
none

Gene Protein Sequence:
MSGAQVRLVVTDMDGTFLDSENNIPPENKQAVKCLHEKNIPFVIATGRML
PMVQEYVRQLQLVGPVVGYNGGMIREIKTGKTIFQKCFAAEAFARVLEYG
MAHRLDYLVYTSDSVYAPDYSVRIRAFHEYNRLARRGGSALIPIFPIEAL
SGDRQRQVMKILVQNFSPSDLETAAEFIGSLHGVHCEHSMPHLIDVMPEG
VDKGNALHILCQYYGISLEQVCVFGDQRNDIVMFKAAGVSFCMRNGHEEA
KKHATYIAESNDDAGFAQALKRYGVVE

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAGGCGCACAGGTTAGGTTGGTGGTTACCGATATGGACGGTACTTT
TTTGGATAGCGAAAATAACATTCCACCTGAGAATAAGCAGGCGGTAAAGT
GTCTGCACGAGAAGAATATCCCTTTTGTTATTGCAACTGGTAGGATGCTG
CCTATGGTGCAGGAGTATGTGCGGCAGTTGCAGTTGGTTGGACCGGTTGT
TGGGTATAACGGGGGAATGATCCGTGAAATTAAGACGGGCAAAACTATTT
TTCAAAAATGTTTTGCTGCTGAAGCATTTGCTCGTGTTTTGGAATACGGC
ATGGCGCATCGCCTAGATTACCTAGTTTATACGTCTGACAGTGTATATGC
ACCGGACTACAGTGTCCGTATACGGGCGTTCCATGAATACAATCGTTTGG
CCCGTCGTGGGGGGAGCGCGCTTATCCCTATCTTTCCCATAGAAGCACTA
TCAGGCGATCGGCAGCGACAGGTTATGAAAATCCTTGTGCAAAATTTTTC
TCCCTCAGATCTTGAAACAGCAGCTGAGTTTATTGGCAGTTTGCATGGAG
TGCACTGTGAACACTCCATGCCGCACCTGATTGATGTAATGCCCGAGGGA
GTGGATAAAGGGAATGCCCTGCATATATTGTGCCAGTACTACGGCATTTC
TTTGGAACAAGTATGCGTGTTTGGTGATCAGAGGAATGATATCGTCATGT
TCAAAGCAGCGGGCGTTTCCTTTTGTATGCGTAATGGTCATGAGGAAGCA
AAAAAACACGCAACGTATATTGCCGAATCTAATGATGATGCAGGTTTTGC
ACAGGCTTTGAAGCGCTATGGGGTGGTAGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy