Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR224 IGR228 IGR225 IGR227 IGR226 IGR223 IGR222 kdtB, - TP0283 TP0287 TP0290 spsF, - TP0288 TP0285 TpN50, - TP0292 prs, - TP0294 TP0289 kdtB, - TP0283 TP0287 TP0290 spsF, - TP0288 TP0285 TpN50, - TP0292 prs, - TP0294 TP0289 Type: tandem, Name:  - 290 Type: tandem, Name:  - 72 Type: tandem, Name:  - 240 Type: tandem, Name:  - 241 kdtB, - TP0283 TP0290 spsF, - TP0288 TP0285 TpN50, - TP0292 prs, - TP0294 TP0289 TP0293 TP0286 TP0284 TP0291 TP0293 TP0284 TP0291 TP0287 TP0286
* Calculated from Protein Sequence

Gene ID: TP0289

DNA Molecule Name:
1  

Genbank ID:
3322568

Gene Name:


Definition:
hypothetical protein

Gene Start:
302153

Gene Stop:
303754

Gene Length:
1602

Molecular Weight*:
59542

pI*:
7.15

Net Charge*:
1.61

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST. Residues 276-349 are 27% similar to a putative protein from A.aeolicus (AE000722).

COGS Summary:  COGS Search
BeTs to 7 clades of COG0500
COG name: SAM-dependent methyltransferases
Functional Class:  R
The phylogenetic pattern of COG0500 is AMTKYQVCEBRHUJgPOLINX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 250-264 are matched to block PR00623D, concerned with histone H4 signature, e.g. H41_EMENI.
Residues 219-230 and 391-435 are matched to blocks BL01183C,D, concerned with methyltransferase sequences, e.g. YOY9_CAEEL.
Residues 187-208 are weakly matched to blocks PR00261A,D,E,F, concerned with LDL sequences, e.g. LDVR_RABIT.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in T.pallidum. TP0289 is very weakly similar to TP0284.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
139  
165
non-globular  
299  
349

PDB Hit:
none

Gene Protein Sequence:
MLALDEGGSGRLNADYLIDVFPVLQSPGRRSLAALTNVRDSAFIPLPETR
KEQDLPVANGRFFPIPGVTTVLVVYGAEDTHGRARSCAERIAALGFDTSV
VVPGEASERTDGKVHIYPSLPHLKEHLHRWDVVVTHFGFTAFEAAAAGAA
VLLVSPTPYHFLLSSAVGFSVIRSADPAAHELWSQMQQGIIIPDVVTRHS
QCRDLADEIMRVARGKKHCCPFCGEMVAVDVVGRALHKTFQRCNECDMIF
LSFVISDPVRYSESYFFEEYKAQYGKTYLEDFDQIRMHGARRMEEIERLY
AEVFCADEGNSFAVDKKVLDVGCAYGAFLSAAKAAGWNAVGVDVCEFAVR
HVRDTLCIPACVATFPLLPECFDFVIRHSFATNRPQQVSVYIRECTFSAV
TLWFVIEHFQDLEAVLRKVADLLVPGGILAFSTPNFAGVTGMRFPHLFFA
QSPCDHFTIWDARTVKKQLLRYGFTVKKIVVTGHHPERFYPHKHLKSGGL
KWKMLMALSKWFQLGDTMEVYAIKQGDAHGSASK

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTTGCTCTGGATGAGGGGGGATCTGGACGTCTGAATGCGGATTACTT
GATAGATGTATTTCCCGTCTTGCAAAGTCCGGGTCGAAGGTCGCTGGCCG
CTCTTACGAATGTACGTGATAGTGCGTTTATCCCACTTCCAGAGACGAGA
AAGGAGCAGGATCTGCCTGTGGCAAACGGCAGATTTTTTCCTATACCTGG
CGTCACCACCGTATTGGTGGTGTATGGGGCAGAAGATACACACGGCCGCG
CGCGTTCGTGTGCTGAGCGGATAGCTGCATTAGGTTTTGACACCTCAGTG
GTAGTTCCTGGTGAAGCGTCTGAACGGACGGACGGTAAGGTGCACATATA
CCCTTCTTTGCCTCATTTGAAAGAGCATCTCCACCGCTGGGACGTGGTAG
TTACCCATTTTGGTTTTACCGCATTTGAGGCTGCAGCTGCAGGGGCGGCG
GTGTTGCTTGTTTCACCAACGCCCTATCATTTTTTACTCTCGAGTGCAGT
GGGTTTTTCTGTTATTCGATCTGCTGATCCTGCTGCGCATGAGTTGTGGT
CTCAGATGCAGCAGGGAATTATTATACCCGATGTTGTGACGCGACATTCG
CAGTGTCGTGATCTGGCAGATGAAATCATGCGCGTTGCGCGGGGGAAAAA
ACACTGCTGTCCTTTTTGTGGAGAAATGGTAGCGGTGGATGTTGTCGGTC
GTGCATTACATAAAACCTTTCAGCGCTGTAATGAATGCGATATGATTTTT
CTCTCCTTTGTAATTTCAGATCCAGTTCGATACTCCGAGTCATATTTTTT
TGAAGAATACAAGGCACAGTATGGCAAGACTTACCTTGAGGACTTTGACC
AAATTCGAATGCATGGTGCGCGCAGGATGGAGGAGATCGAACGCTTATAT
GCAGAAGTTTTTTGTGCAGATGAAGGTAATTCGTTTGCAGTTGATAAAAA
GGTTTTAGATGTTGGCTGTGCATATGGCGCTTTCTTGTCTGCGGCAAAGG
CTGCGGGGTGGAATGCTGTTGGGGTTGATGTCTGTGAATTTGCGGTGCGT
CATGTGCGAGACACACTCTGCATTCCTGCTTGTGTTGCAACGTTTCCATT
ACTTCCTGAGTGTTTTGACTTTGTGATTCGGCACAGCTTTGCCACGAATC
GTCCCCAACAAGTATCTGTTTACATTCGAGAGTGTACGTTCTCCGCCGTT
ACCCTGTGGTTTGTGATAGAGCATTTTCAGGACCTGGAGGCGGTACTCAG
GAAGGTGGCAGATCTTTTAGTGCCTGGAGGTATTCTTGCCTTTTCTACCC
CTAATTTTGCAGGTGTCACTGGTATGCGTTTTCCGCATCTTTTTTTTGCG
CAGAGTCCTTGCGATCATTTTACAATATGGGATGCGCGCACGGTAAAAAA
GCAGCTCTTGCGCTACGGTTTTACGGTAAAGAAAATAGTGGTGACTGGTC
ATCATCCCGAGCGATTTTATCCTCACAAGCATTTAAAATCTGGTGGGTTG
AAATGGAAGATGCTGATGGCATTGAGCAAATGGTTCCAATTAGGAGACAC
TATGGAGGTGTACGCGATAAAGCAAGGAGACGCGCATGGATCTGCGAGTA
AG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy