Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR224 IGR221 IGR225 IGR227 IGR226 IGR223 IGR222 TP0280 kdtB, - TP0283 TP0287 TP0282 TP0290 spsF, - TP0288 TP0285 TpN50, - TP0292 TP0289 rpsA, - TP0279 TP0280 kdtB, - TP0283 TP0287 TP0282 TP0290 spsF, - TP0288 TP0285 TpN50, - TP0292 TP0289 rpsA, - TP0279 Type: tandem, Name:  - 290 Type: tandem, Name:  - 72 Type: tandem, Name:  - 240 Type: tandem, Name:  - 241 kdtB, - TP0283 TP0282 TP0290 spsF, - TP0288 TP0285 TpN50, - TP0292 TP0289 TP0281 TP0286 TP0284 TP0291 TP0284 TP0291 TP0287 rpsA, - TP0279 TP0286 TP0280 TP0281
* Calculated from Protein Sequence

Gene ID: TP0288

DNA Molecule Name:
1  

Genbank ID:
3322556

Gene Name:
spsF  

Definition:
spore coat polysaccharide biosynthesis protein F

Gene Start:
301183

Gene Stop:
302127

Gene Length:
945

Molecular Weight*:
35269

pI*:
6.43

Net Charge*:
-3.82

EC:
 

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides, and antigens  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed the N-terminal and middle portion has two strong
hits to spore coat polysaccharide biosynthesis proteins. For example
residues 8-205 are 30% similar to SPSF_BACSU of Bacillus subtilis,
(X73124).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1861
COG name: Spore coat polysaccharide biosynthesis protein F (SpsF), CMP-KDO synthetase homolog
Functional Class:  M
The phylogenetic pattern of COG1861 is -m-------b-------l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 8-205 are 32% similar to spore coat polysaccharide biosynthesis
protein of SPSF_BACSU. Residues 10-68 are 49% similar to 3-DEOXY-MANNO-
OCTULOSONATE CYTIDYLYLTRANSFERASE of KDSB_ECOLI.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T. pallidum.

Pfam Summary:  Pfam Search
Residues 9 to 264 (E-value = 2.4e-82) place TP0288 in the CTP_transf_3 family which is described as Cytidylyltransferase (PF02348)

PDB Hit:
none

Gene Protein Sequence:
MEQDRSGVAVIVQARVDSTRLPGKALLPLMGEPLIHYVLQATRVIPAETY
ILACDEHSKKDFEPVARAHGFYCISGSAEDVLHRFCIAVKAFEHSFPIRT
VVRVTGDNPFLFHEAAAAALLRYAELDEPDYFTFTGLPYGSGVEILKARS
LLLADRLPLEAYDREHVGPALHRRPGIFVCVREPAAAAWYHPDVRVTVDT
QEDFQRAQHMMEYVCTLQCPFPLSSDVILDAYAYARQVVVFVPSVKIGQG
AGHLYRAAYLVLRLQGRVRCCLYVPDRSLLCKLSTPFPEELIVDTVPADA
SLIVVDNFRTCYVRD

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGCAGGATCGTTCCGGTGTTGCAGTTATTGTGCAAGCACGCGTTGA
TTCTACGCGGTTACCAGGAAAGGCGCTGTTGCCCCTTATGGGGGAGCCGC
TGATACATTACGTGTTGCAGGCAACGCGGGTCATCCCTGCAGAAACGTAT
ATTCTTGCGTGTGATGAACATTCTAAAAAAGATTTTGAACCCGTTGCGCG
CGCGCATGGGTTCTACTGTATTTCAGGATCGGCAGAAGATGTGCTCCACC
GCTTTTGTATCGCAGTTAAGGCTTTTGAGCATTCGTTCCCAATTCGAACC
GTCGTGCGGGTTACCGGAGATAACCCTTTTTTGTTTCACGAAGCAGCTGC
TGCAGCGCTCCTGCGTTATGCGGAACTGGACGAGCCAGATTATTTTACCT
TCACTGGTCTTCCCTACGGCAGCGGAGTGGAAATATTAAAGGCGCGCTCG
TTGCTTTTAGCAGATCGTCTTCCTTTGGAGGCGTACGACCGTGAGCATGT
AGGACCTGCCTTACATCGCCGCCCGGGTATTTTCGTGTGTGTGCGTGAAC
CTGCCGCTGCCGCATGGTATCACCCTGATGTGCGAGTAACGGTGGACACG
CAGGAAGACTTTCAGCGAGCGCAGCATATGATGGAGTACGTGTGCACGTT
GCAGTGTCCGTTTCCGCTCTCTTCCGATGTTATTTTAGATGCGTATGCGT
ACGCGCGGCAGGTGGTGGTATTTGTACCCTCAGTGAAAATAGGACAGGGA
GCGGGGCATTTATATCGGGCGGCGTATTTAGTCTTGCGACTGCAAGGACG
TGTGCGCTGTTGCTTGTATGTGCCCGATCGTAGTTTGCTGTGCAAACTGT
CTACTCCCTTTCCTGAGGAACTGATAGTGGACACGGTTCCTGCGGATGCA
TCACTGATAGTGGTCGACAACTTCCGTACTTGCTACGTGCGAGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy