Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR224 IGR221 IGR225 IGR227 IGR226 IGR223 IGR222 TP0280 kdtB, - TP0283 TP0287 TP0282 TP0290 TP0291 spsF, - TP0288 TP0285 TP0289 rpsA, - TP0279 TP0280 kdtB, - TP0283 TP0287 TP0282 TP0290 TP0291 spsF, - TP0288 TP0285 TP0289 rpsA, - TP0279 Type: tandem, Name:  - 290 Type: tandem, Name:  - 72 Type: tandem, Name:  - 240 Type: tandem, Name:  - 241 kdtB, - TP0283 TP0282 TP0291 spsF, - TP0288 TP0285 TP0289 rpsA, - TP0279 TP0281 TP0286 TP0284 TP0284 TP0287 TP0280 TP0290 TP0286 TP0281
* Calculated from Protein Sequence

Gene ID: TP0285

DNA Molecule Name:
1  

Genbank ID:
3322567

Gene Name:


Definition:
hypothetical protein

Gene Start:
299177

Gene Stop:
300253

Gene Length:
1077

Molecular Weight*:
41242

pI*:
5.85

Net Charge*:
-7.19

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant matches in gapped BLAST. Residues 81-132 are 36%
similar to a stretch of yeast ATP-dependent RNA helicase (Z74132).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
Residues 86-99 and 128-141 are matched to block PR00847B, which
encompasses bee venome hyaluronidase.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No evidence of paralogs in T.pallidum, however residues 25-91 are
weakly similar (27%, E value 0.045) to a stretch of TP0624, a
conserved hypothetical.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
none

Gene Protein Sequence:
MFCTSFIFESIKTDINSFDLETMIAPVDVRHLRLEFYTSSKAQFLQCAAF
TDITAENYAQLISAREHALRTVPAYYALELTRAYPLSSLYRPVSFPAQVE
NASLMPKEEACALIRRIADFSERAVISLSVFGDPVLYPALCDVVREILKY
PGLSVLIETSGLGWQESVVRDLCECARNSARTPFAIGWIVFLDAVSSGMY
SQVHRVSLSEAEFFLKEATEFAMQVHAQCPGVLWPQIFRMNENEKELEPF
YRTWKERVGQVIVQKYDHVCGLLPDRRVADLSPLERYPCWHLKRDMIIFT
DGRVPLCKEDVHCRHALGNAFQQDLAQIWRRGQDVYLQHVRAVHEGLCGQ
CDEYYTYNF

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTTTGCACTTCGTTCATTTTTGAGAGCATTAAAACAGACATTAATTC
TTTTGATCTAGAAACTATGATTGCGCCGGTTGATGTGCGGCATCTGCGTC
TGGAATTTTATACGAGTTCTAAGGCGCAGTTCTTGCAGTGTGCTGCATTT
ACCGATATCACTGCAGAAAATTACGCACAGCTTATCAGCGCACGTGAGCA
TGCGTTGCGCACAGTTCCTGCGTACTATGCGCTTGAGTTGACGCGTGCGT
ATCCGCTTTCTTCGTTGTATCGGCCAGTATCTTTTCCTGCGCAGGTGGAG
AATGCTTCACTGATGCCAAAAGAGGAAGCGTGTGCGTTGATCCGGCGCAT
TGCAGACTTTTCAGAACGTGCGGTCATTTCGCTTTCGGTATTTGGGGATC
CGGTGTTGTATCCTGCACTGTGTGACGTCGTACGTGAGATTCTCAAGTAT
CCGGGTTTGTCGGTGCTCATTGAGACAAGTGGGTTGGGGTGGCAGGAGTC
TGTAGTGCGTGATTTGTGCGAATGTGCGCGCAACAGTGCGCGCACTCCTT
TTGCCATTGGCTGGATTGTGTTTTTAGATGCGGTGAGTTCAGGCATGTAC
AGTCAGGTACACCGTGTGTCGCTGTCAGAAGCGGAATTTTTTCTAAAAGA
AGCGACGGAATTTGCAATGCAGGTACATGCGCAATGTCCGGGCGTGCTGT
GGCCACAGATTTTCCGTATGAATGAAAACGAAAAAGAGCTCGAGCCCTTT
TACCGCACGTGGAAGGAGCGTGTGGGGCAGGTGATTGTTCAAAAGTATGA
TCATGTGTGCGGATTGCTTCCCGATCGGCGGGTTGCAGATCTATCTCCTT
TGGAGAGGTATCCGTGTTGGCATCTAAAACGAGATATGATTATTTTCACT
GATGGTCGAGTTCCGCTGTGCAAAGAAGATGTGCACTGTCGCCACGCGCT
GGGCAATGCTTTCCAGCAGGATCTTGCACAGATTTGGCGGCGGGGACAGG
ATGTGTATCTTCAGCACGTTCGTGCAGTACATGAAGGATTATGTGGGCAG
TGTGATGAGTACTATACCTATAATTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy