Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Treponema pallidum Search Results

Record: 1 of 1  
MiniMap IGR224 IGR221 IGR225 IGR220 IGR226 IGR223 IGR219 IGR222 ctp, - TP0277 TP0278 TP0280 kdtB, - TP0283 TP0287 TP0282 TP0290 spsF, - TP0288 TP0285 TP0289 rpsA, - TP0279 ctp, - TP0277 TP0278 TP0280 kdtB, - TP0283 TP0287 TP0282 TP0290 spsF, - TP0288 TP0285 TP0289 rpsA, - TP0279 Type: tandem, Name:  - 240 Type: tandem, Name:  - 71 Type: tandem, Name:  - 290 Type: tandem, Name:  - 72 Type: tandem, Name:  - 239 Type: tandem, Name:  - 241 ctp, - TP0277 TP0278 kdtB, - TP0283 TP0282 TP0290 spsF, - TP0288 TP0285 TP0289 rpsA, - TP0279 TP0281 TP0286 TP0284 TP0284 TP0287 TP0280 TP0286 TP0281
* Calculated from Protein Sequence

Gene ID: TP0284

DNA Molecule Name:
1  

Genbank ID:
3322566

Gene Name:


Definition:
hypothetical protein

Gene Start:
298578

Gene Stop:
299234

Gene Length:
657

Molecular Weight*:
23546

pI*:
6.10

Net Charge*:
-2.56

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Gapped BLAST revealed no significant hits in the database.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
Residues 21-41, 54-72, 142-162 are weakly matched (86%) to blocks
PR00749A,C,H, concerned with lysozyme signatures, e.g. LYG_ANSAN.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
There is no evidence of paralogs in T.pallidum.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
179  
212

PDB Hit:
none

Gene Protein Sequence:
MRADKGAVGTVAVVCAFDLSDYAFVPLCGTREQSCMKAVPGFVPCVEVRG
CESTAGVGRRCAFERAVTAAYALPGCHQVCVYADAASAAKVARFMQCATP
IFPSLRVNVLDDMRVSAFFAHVARVCAEYAQLGEEPEAVFVLRADAPFID
SVASAQLYAQHREYLAEYSFADGYPEGLFAAVVAPGLFPILATLTQDAHI
CFALRSFLRALKQTLILLI

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTGCCGATAAAGGGGCGGTGGGAACGGTTGCTGTGGTCTGTGCCTT
TGATCTGAGCGATTATGCCTTTGTGCCCTTGTGTGGCACGCGTGAGCAGT
CGTGTATGAAAGCAGTGCCGGGGTTCGTGCCGTGCGTGGAGGTGAGGGGC
TGTGAGAGTACAGCCGGGGTGGGGCGGCGTTGCGCTTTCGAGCGTGCTGT
TACAGCTGCTTACGCGTTGCCTGGTTGCCATCAGGTGTGTGTGTACGCGG
ATGCGGCGAGCGCCGCGAAGGTTGCGCGTTTTATGCAGTGCGCTACGCCT
ATTTTTCCGTCGCTGCGCGTGAACGTTCTGGATGACATGCGAGTGAGCGC
CTTCTTCGCGCATGTTGCACGCGTATGTGCGGAATACGCGCAATTGGGTG
AAGAACCTGAGGCTGTCTTTGTTCTGCGCGCAGACGCGCCCTTTATTGAT
AGTGTGGCGAGCGCCCAGTTATACGCGCAGCATCGCGAATATCTTGCAGA
GTATAGTTTTGCAGATGGCTACCCGGAGGGGTTATTTGCTGCAGTTGTTG
CGCCAGGACTTTTCCCCATCCTTGCTACTTTGACTCAGGATGCACATATT
TGTTTTGCACTTCGTTCATTTTTGAGAGCATTAAAACAGACATTAATTCT
TTTGATC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy